Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52k2 Olfactory Receptor

Gene Symbol Or52k2
Organism Mouse
Family 52
Subfamily k
Pseudo No
Location chr7:102,604,000-102,605,000 (+)
Aliases Olfr552

Sequence information


Nucleotide sequence

MLVNNITSTHPVAFLLMGIPGLEHLHIWISIPFCSAYTLAVLGNCTLLFIIRVDAALHEP
MYLFLAMLAAIDLVLSSSTLPKMLSLFWFRDREINFHACLIQMFFLHSFAIMESAMLLAM
AFDRYVAICKPLHYTTILTKPLIIKIGLAAVTRAVTLMTPLPFLLRRFHYCRGTVIAHCY
CEHMAVVRLACGDTRFNNIYGIAVAMFIVVLDLLFVILSYIFILRAVLQLASQEARYKAF
GTCVSHIGAILAFYTPVVISSVMHRVARRAAPHVHILLANFYLLFPPMVNPIIYGVKTKQ
IRERVLGLFLRKDLKGE


Conceptual translation

MLVNNITSTHPVAFLLMGIPGLEHLHIWISIPFCSAYTLAVLGNCTLLFIIRVDAALHEP
MYLFLAMLAAIDLVLSSSTLPKMLSLFWFRDREINFHACLIQMFFLHSFAIMESAMLLAM
AFDRYVAICKPLHYTTILTKPLIIKIGLAAVTRAVTLMTPLPFLLRRFHYCRGTVIAHCY
CEHMAVVRLACGDTRFNNIYGIAVAMFIVVLDLLFVILSYIFILRAVLQLASQEARYKAF
GTCVSHIGAILAFYTPVVISSVMHRVARRAAPHVHILLANFYLLFPPMVNPIIYGVKTKQ
IRERVLGLFLRKDLKGE