Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or52l1 Olfactory Receptor

Gene Symbol Or52l1
Organism Rat
Family 52
Subfamily l
Pseudo No
Location chr1:170,073,000-170,074,000 (-)
Aliases Olr196

Sequence information


Nucleotide sequence

ATGACTCTGGTGACTTCGCACTCTTCTTTCTCTGTGCTGTTGTTCATGGCTCTTAGCAAC
TCCAGCTGGAGGCAACCCCAGCCCCCTTTCTTCCTAGTAGGTGTTCCGGGCTTGGAGGAA
AGTCAGCACTGGATAGCATTGCCTCTGGGGGTCCTTTACCTCCTTGCTCTAGTGGGCAAT
GTGACAATTATCTTCATTATCTGGACTGACTCATCCTTGCACCAACCTATGTACCTCTTC
CTGGCCATGCTTGCTGCTATTGATCTGGTCCTGGCCTCCTCCACTGCGCCTAAAGCTCTC
ACTGTGCTTCTGGCTCACGCCCATGAGATTGGGTACATTGTCTGCCTCACTCAGATGTTT
TTCATTCATGCCTTCTCCTCGATGGAGTCAGGCATACTTGTGGCCATGGCTCTGGATCGC
TATGTTGCCATCTGCCACCCTCTGCATCATTCTACCATCCTGCATCCGGGGATTATTGGG
CGCATCGGGATGGTGGTGCTGGTGCGGGGATTGGTCCTCCTTGTCCCATTCCCCATCCTG
TTGCAGAAAGTTGTCTTCTGCAGAGCCACTGTCATAAGCCATGCCTATTGTGAACATATG
GCTGTGGTAAAACTTGCCTGTTCGGAAACCACAGTGAATCGAGCTTATGGGCTGTCAGTG
GCACTGCTGGTGGTTGGGCTAGATGTCCTGGCCATTAGCATTTCCTATGCCCTCATCCTC
CAGGCAGTGCTGAAGGTTCCAGGAGGTGAAGCCAGACTTAAGGCCTTCAGCACATGTGGA
TCTCATGTTTGTGTTATTCTCATCTTCTATGTCCCTGGAATGTTCTCCTTCCTCACTCAC
CGCTTTGGCCACCATGTTCCCCATCATGTCCACGTTCTGCTGGCCACTCTCTATCTCCTT
GTGCCACCTGCCCTCAATCCTCTTGTTTATGGGGTGAAGACTCGACAGATCCGCCAGCGA
GTGCTCAGGGTGTTCTACACAAAAGCATCGAGT


Conceptual translation

MTLVTSHSSFSVLLFMALSNSSWRQPQPPFFLVGVPGLEESQHWIALPLGVLYLLALVGN
VTIIFIIWTDSSLHQPMYLFLAMLAAIDLVLASSTAPKALTVLLAHAHEIGYIVCLTQMF
FIHAFSSMESGILVAMALDRYVAICHPLHHSTILHPGIIGRIGMVVLVRGLVLLVPFPIL
LQKVVFCRATVISHAYCEHMAVVKLACSETTVNRAYGLSVALLVVGLDVLAISISYALIL
QAVLKVPGGEARLKAFSTCGSHVCVILIFYVPGMFSFLTHRFGHHVPHHVHVLLATLYLL
VPPALNPLVYGVKTRQIRQRVLRVFYTKASS