Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52m1 Olfactory Receptor

Gene Symbol Or52m1
Organism Mouse
Family 52
Subfamily m
Pseudo No
Location chr7:102,640,000-102,641,000 (+)
Aliases Olfr554

Sequence information


Nucleotide sequence

MAQEYCFFFLSREKCLATFGDTNENYLYTTMSTFHNVCSVPSSLWLTGIPGLETLHIWLS
IPFGSMYLVAVVGNITILAVVRVERSLHQPMYFFLCMLAVIDLVLSTSTMPKLLAIFWFG
AGHIGLDACLCQMFLIHCFATVESGIFLAMAFDRYVAICNPLRHSMVLTHTVVGRLGLAA
VLRGVLYIGPLPLMIRLRLPLYKTRVISHSYCEHMAVVALTCGDSRVNNVYGLSIGFLVL
ILDSAAIAASYVMIFRAVMGLATPEARLKTLGTCGSHICAILIFYVPIAVSSLIHRFGHQ
VPPPIHTLLANFYLLIPPILNPIVYAVRTKQIRDRLLQILKTGTKIR


Conceptual translation

MAQEYCFFFLSREKCLATFGDTNENYLYTTMSTFHNVCSVPSSLWLTGIPGLETLHIWLS
IPFGSMYLVAVVGNITILAVVRVERSLHQPMYFFLCMLAVIDLVLSTSTMPKLLAIFWFG
AGHIGLDACLCQMFLIHCFATVESGIFLAMAFDRYVAICNPLRHSMVLTHTVVGRLGLAA
VLRGVLYIGPLPLMIRLRLPLYKTRVISHSYCEHMAVVALTCGDSRVNNVYGLSIGFLVL
ILDSAAIAASYVMIFRAVMGLATPEARLKTLGTCGSHICAILIFYVPIAVSSLIHRFGHQ
VPPPIHTLLANFYLLIPPILNPIVYAVRTKQIRDRLLQILKTGTKIR