Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or52n1b Olfactory Receptor

Gene Symbol Or52n1b
Organism Rat
Family 52
Subfamily n
Pseudo No
Location chr1:169,742,000-169,742,000 (+)
Aliases Olr164

Sequence information


Nucleotide sequence

ATGTCACTTCTAAATGTCAGCAGCCTGACTCCAGCTTCATTAATCCTCAATGGCATCCCT
GGTCTGGAAGAGGTTAATTTGTGCATCTTTTTCCCACTGTTTACCATGTATAGCATTGCC
CTTACAGGGAACTTTGGACTTATATATCTTATCTATTCTGAAGAGGTCTTACACAGACCT
ATGTACATCTTCTTAGCCCTTCTTTCCTTCACAGATGTGCTCATGTGCACCAGCACCATT
CCCAACACTCTCTTCATATCGTGGTTCAATTTCAAGAAGATTGACTTTAAGGCCTGCCTG
GCTCAGATGTTCTTTGTGCACACTTTCACAGGAATGGAGTCCGGGGTGCTTGTGCTTATG
GTCCTGGACCTCTACATAGCCATGTGTTACCCTCTGCGCTATGCCACTATCCTCACTAAT
GTGGTCATCGCCAAGGCAGGGATGCTTACTTTTCTTCGGGGAGTGGCTCTTGTCATTCCC
TTCATATTCCTCACCAAGCGCTTTCCGTACTGCAAGGGCAATGTCATCCCCCACACCTAC
TGTGACCACATATCTGTTGCTAAAATATCCTGTGGCAATGTTCAGATCAATGCCATCTAT
GGTTTAATGGTTGTCCTCCTGATTGGGGACTTTGACATCCCGTGCATCACAGTTTCCTAC
ACCATGATCCTTTGGGCCGCTGTGAGTCTGTCATCAGCAGATGCTAGACAGAAAGCTTTC
AGCACCTGCACTGCTCACATATGTGCCATTGTCATCACCTACGTCCCAGCCTTTTTCACC
TTCTTTACACACCGCTTTGGGTGGCATACCATCCCTTCCCACATACATATCATTATGGCT
AATCTGTATCTACTCATGCCTCCCACCATGAACCCTATTGTGTATGGGGTGAAAACCAAG
CAGATACAAAAGAGGGTCATTAGGTTCTTTTTTAAAGGGAGAGAAAATTCTTCTCATAAA
TTT


Conceptual translation

MSLLNVSSLTPASLILNGIPGLEEVNLCIFFPLFTMYSIALTGNFGLIYLIYSEEVLHRP
MYIFLALLSFTDVLMCTSTIPNTLFISWFNFKKIDFKACLAQMFFVHTFTGMESGVLVLM
VLDLYIAMCYPLRYATILTNVVIAKAGMLTFLRGVALVIPFIFLTKRFPYCKGNVIPHTY
CDHISVAKISCGNVQINAIYGLMVVLLIGDFDIPCITVSYTMILWAAVSLSSADARQKAF
STCTAHICAIVITYVPAFFTFFTHRFGWHTIPSHIHIIMANLYLLMPPTMNPIVYGVKTK
QIQKRVIRFFFKGRENSSHKF