Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52n20 Olfactory Receptor

Gene Symbol Or52n20
Organism Mouse
Family 52
Subfamily n
Pseudo No
Location chr7:104670704-104671669 (+)
Aliases Olfr659, MOR34-4

Sequence information


Nucleotide sequence

ATGCTCCTGCTGAATCAAACAGAGGTGACCCCAGTCTCATTTATTCTGAATGGAATCCCA
GGCCTGGAAGAAATGCACATCTGGATTTCCTTCCCATTCTGTTCTATGTATGTAATAGCT
GTGGTAGGCAATTGTGGACTCCTCTACCTCATCTTCTTTGAAGACAGCCTTCACAGGTCA
ATGTACTACTTCTTGGCTATGCTTTCCCTTACAGACCTTGTCATGTGCAGTGCTTCAATA
CCCAAAACTCTCTGTATCTTCTGGTTCTACATTAAGGAAATTAGCTTTACTGATTGTCTG
GTCCAGATGTTCTTCATCCATACTTTCACAGCGATGGAGTCTGGGGTGCTCATGCTCATG
GCTCTGGACCGCTATGTAGCAATCTGCTACCCTCTGCACTACTCCACTATCCTCACCAAT
CCTGTCATTGCAAAAGCTGGCCTTGCTACATTCTTGAGAGCTGTGGTGCTCATCATTCCT
TTGATTTTCATCACAAAGCATCTGCCCTTCTGCAGAAGCAATATATTAATACACCATACC
TACTGTGACCAGTTGTCTGTAGCCAAGGTCTCCTGTGGAAATATCAAGGTCAACATTGTC
TATGGTCTGATGATTGCTCTCTTTATTGGGGGCTTTGATATCTTGTGCATCACAGTCTCC
TACACCATGATCCTGAAAGCAGTGGTCAGCTTATCTTCAGCAGATGCTAGGCAGAAAGCT
TTCAGCACCTGCACTGCCCACATCTGTGCCATTGTTTTCTCCTATAGCCCAGCCTTCTTT
TGTTTCTTTTCCCACCGCTTTGGGGGGCACATCATCCCTCCATCTTGCCTCATCATTGTG
GCTAACCTTTATCTGCTTTTGCCTCCCACTATGAACCCTGTGGTCTATGGAGTGAAAACC
AAGCAGATACGAGACTGTGTCATAAGGATCTTTTCAGGTTCTAAGGACATCAAATCCCAC
AGCATA


Conceptual translation

MLLLNQTEVTPVSFILNGIPGLEEMHIWISFPFCSMYVIAVVGNCGLLYLIFFEDSLHRS
MYYFLAMLSLTDLVMCSASIPKTLCIFWFYIKEISFTDCLVQMFFIHTFTAMESGVLMLM
ALDRYVAICYPLHYSTILTNPVIAKAGLATFLRAVVLIIPLIFITKHLPFCRSNILIHHT
YCDQLSVAKVSCGNIKVNIVYGLMIALFIGGFDILCITVSYTMILKAVVSLSSADARQKA
FSTCTAHICAIVFSYSPAFFCFFSHRFGGHIIPPSCLIIVANLYLLLPPTMNPVVYGVKT
KQIRDCVIRIFSGSKDIKSHSI