Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52n2b Olfactory Receptor

Gene Symbol Or52n2b
Organism Mouse
Family 52
Subfamily n
Pseudo No
Location chr7:104916317-104917294 (-)
Aliases Olfr667, MOR34-11, MOR34-2

Sequence information


Nucleotide sequence

ATGTCTGAAGCCAACAGCTCCAGCCTGACCCCAGAATTCTTTATACTGAATGGTATCCGT
GGGCTGGAAGATGCACATGTCTGGATCTCTCTGCCATTCTGTTTCATGTACATGATTGCT
GTGGTGGGGAACTGTGGGCTTATCTACCTCATTGGCCATGAGGAGGCTCTGCACCGGCCC
ATGTACTACTTTCTAACCCTGCTCTCCTTCACTGATATAACCTTATGTACCACTACTGTA
CCCAATATGCTGTGTATATTCTGGTTCAACCTCAAGAAGATTGGATTTAAAGCCTGCCTG
GCCCAGATGTTCTTTGTGCATACCTTCACAGCAACAGAGTCTGGCATGCTAATGCTCATG
GCCCTGGATCGCTATGTGGCCATCTGCTATCCTTTGCGCTACGGGACCATCCTGACCAAC
CCTGTGATTGCCAAAGCTAGTCTTGCTACTTTCTTGAGGAGTGTGGCATTCATCCTTCCT
TTCACTTTCCTCACTAAGCGCCTGCCCTATTGCCGAGGAAACCTCATCCCCCATGCCTAC
TGTGACCACATGTCTGTGGCCAAGATATCCTGTGGCAATGTGAAAATCAATGCAGTCTAT
GGTCTGCTGGTTGCTCTTGTGGTTTGTGCATTTGACATATTCTGTATCACTGTGTCATAC
ACAATGATATTGAGAGCAGTGATGAACCTGTCTTCTGCTGATGCTCGTCACAAGGCCTTC
AGCACCTGCACATCTCACATCTGTGCTATTGTGATCACTTATGTGCCTGCTTTTTTTAAT
TTCTTCACTCATCGTTTTGGAGCACATACTATTCCCCACCACATCCACATCATAGTGGCA
AACCTCTATCTGTTATTGCCTGCTACCATGAACCCAATTGTTTATGGAGTCAAGACCAAG
CAGATTCGGGAGAGTGTAATCAAATTTTTTAGTGGAGACAAGAGTGACATTGTTGATATA
AAAGGATTAAAAAACAAG


Conceptual translation

MSEANSSSLTPEFFILNGIRGLEDAHVWISLPFCFMYMIAVVGNCGLIYLIGHEEALHRP
MYYFLTLLSFTDITLCTTTVPNMLCIFWFNLKKIGFKACLAQMFFVHTFTATESGMLMLM
ALDRYVAICYPLRYGTILTNPVIAKASLATFLRSVAFILPFTFLTKRLPYCRGNLIPHAY
CDHMSVAKISCGNVKINAVYGLLVALVVCAFDIFCITVSYTMILRAVMNLSSADARHKAF
STCTSHICAIVITYVPAFFNFFTHRFGAHTIPHHIHIIVANLYLLLPATMNPIVYGVKTK
QIRESVIKFFSGDKSDIVDIKGLKNK