Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or52n2d-ps Olfactory Receptor

Gene Symbol Or52n2d-ps
Organism Rat
Family 52
Subfamily n
Pseudo Yes
Location chrUn_KL568409v1:260,706-261,524 (-)
Aliases Olr173-ps

Sequence information


Conceptual translation

MSGVNSSSLIPEVFILNGVPGLEDAHVWISLPFCLMYIIAVVGNCGLIYLIGHEEVLHRP
MYYLLVLFSFNNVILSTG/TDTMPNMLCIFWFNLKKIGFKACLAQMVSVHTFTATESGM
LMLMALDRYVAICYPLRYGTILTNPVIPK*VLL/FLKSVSFILPFTFLTKCLSYC*GRL
IPHAYCDHMSVANISCGNVKINAVYGLLVVGGGADSKVWFPNSFLILSIKKAGANC