Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or52n2e Olfactory Receptor

Gene Symbol Or52n2e
Organism Rat
Family 52
Subfamily n
Pseudo No
Location chrUn_KL568409v1:318,309-319,262 (-)
Aliases Olr176

Sequence information


Nucleotide sequence

ATGTCTGGATCCAACAGCTCCAGCCTGATCCCAGAATTCTTTATCCTCAATGGTGTTCCT
GGGCTGGAAGATGCACATGTCTGGATCTCTCTGCCATTCTGCTTCATGTACATGATTGCT
GTGGTGGGGAACTGTGGGCTTATCTACCTCATTGGCCATGAGGAGGCTCTGCACAGACCC
ATGTACTACTTCCTGGCCTTACTCTCCTTCACTGATGTTACCTGGTGTACTACCACTGTG
CCCAATATGCTGTGCATATTCTGGTTCAACTTTAAGAAGATCGGATTTAATTCCTGCCTT
GTCCAGATGTTCTTTGTCCACATGTTGACTGGAATGGAGTCTGGTGTGCTCATGCTGATG
GCCCTGGACCGCTATGTAGCCATCTGCTATCCTCTTCGATATACCTCCATCCTCACCAAC
CCTGTGATTGCCAAGGCTGGGCTTGCTACATTCATGAGGAGTGTCATGCTCATCTTTCCA
TTCACTCTCCTCACCAAGCGCTTGCCCTATTGCAGAGGCACCCTTATCCCCCACACTTAC
TGTGATCACATGTCTGTGGCTAAGGTATCCTGTGGCAATGCCAAGGTCAACGCAATATAT
GGCCTCATGGTTGCTCTGTTGATTGGTGTGTTTGACATTTGCTGTATCTCTGTGTCTTAC
ACTATGATACTGAGGGCAGTGGTGAGTCTGTCCTCTGCTGATGCTCGTCACAAGGCCTTC
AGCACCTGCACATCTCATATCTGTGCTATTGTGATCACTTATGTGCCTGCCTTTTTCACT
TTCTTTACTCATCGTTTTGGAGGAAACACTATTCCCCACCACATCCACATCATAGTGGCC
AACCTCTACCTGCTCTTGCCCCCTACCATGAACCCAATTGTTTATGGAGTCAAGACCAAG
CAGATTCGGGAAAGTGTAATCAAGTTTTTACTTGGAGACAAAATAAGCAATACC


Conceptual translation

MSGSNSSSLIPEFFILNGVPGLEDAHVWISLPFCFMYMIAVVGNCGLIYLIGHEEALHRP
MYYFLALLSFTDVTWCTTTVPNMLCIFWFNFKKIGFNSCLVQMFFVHMLTGMESGVLMLM
ALDRYVAICYPLRYTSILTNPVIAKAGLATFMRSVMLIFPFTLLTKRLPYCRGTLIPHTY
CDHMSVAKVSCGNAKVNAIYGLMVALLIGVFDICCISVSYTMILRAVVSLSSADARHKAF
STCTSHICAIVITYVPAFFTFFTHRFGGNTIPHHIHIIVANLYLLLPPTMNPIVYGVKTK
QIRESVIKFLLGDKISNT