Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52n3 Olfactory Receptor

Gene Symbol Or52n3
Organism Mouse
Family 52
Subfamily n
Pseudo No
Location chr7:104,881,000-104,882,000 (+)
Aliases Olfr665

Sequence information


Nucleotide sequence

MPGVNTSSLTPRYFILNGIPGLEAAHIWISLPFFIMYLIAVTGNCGLIYLISHEEALHRP
MYYFLAMLSATDISGCNTIVPSMLCIFWFSVKEIDFNACLVQMFFIHMLTGMESGVLMLM
ALDRYVAICYPLRYTTILTNTMITKIGLAALVRSVLLMVPFAFLIKRLPYCRGNLIQHTY
CDHMAVAKLSCGNIKINAIYGLIIAIFIGGFDIFCISMSYAMIIHAVVKLSSADARHKAF
STCTSHICAIVITYVPAFFNFFTHRFGRTTIPHHIHIIIANLYLLLPPTLNPIVYGVKTK
QIREGVIKLFARQKVV


Conceptual translation

MPGVNTSSLTPRYFILNGIPGLEAAHIWISLPFFIMYLIAVTGNCGLIYLISHEEALHRP
MYYFLAMLSATDISGCNTIVPSMLCIFWFSVKEIDFNACLVQMFFIHMLTGMESGVLMLM
ALDRYVAICYPLRYTTILTNTMITKIGLAALVRSVLLMVPFAFLIKRLPYCRGNLIQHTY
CDHMAVAKLSCGNIKINAIYGLIIAIFIGGFDIFCISMSYAMIIHAVVKLSSADARHKAF
STCTSHICAIVITYVPAFFNFFTHRFGRTTIPHHIHIIIANLYLLLPPTLNPIVYGVKTK
QIREGVIKLFARQKVV