Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52n4 Olfactory Receptor

Gene Symbol Or52n4
Organism Mouse
Family 52
Subfamily n
Pseudo No
Location chr7:104,644,000-104,645,000 (-)
Aliases Olfr658

Sequence information


Nucleotide sequence

MVMSVQNSTDLTPASFVLNGIPGLEDMHIWISFPFCSMYAVAMMGNCGLLYLIFFEDSLH
RPMYYFLAMLSLTDLVMCSSTIPKTLCIFWFHLKEIGFDDCLVQMFFIHTFTGMESGVLM
LMALDRYVAICYPLRYSTILTNPIIAKIGLATFLRGVLLIIPFTFLTKRLPYCRGNIINH
TYCDHMSVAKLSCGNVKVNAIYGLMVALLIGGFDILCITISYTMILRAVVSLSSADARQK
AFSTCTAHICAIVFSYSPAFFSFFSHRFGGHTIPPSCHIIVANIYLLLPPTMNPVVYGVK
TKQIRDCVIRILSGSKDSKAHGI


Conceptual translation

MVMSVQNSTDLTPASFVLNGIPGLEDMHIWISFPFCSMYAVAMMGNCGLLYLIFFEDSLH
RPMYYFLAMLSLTDLVMCSSTIPKTLCIFWFHLKEIGFDDCLVQMFFIHTFTGMESGVLM
LMALDRYVAICYPLRYSTILTNPIIAKIGLATFLRGVLLIIPFTFLTKRLPYCRGNIINH
TYCDHMSVAKLSCGNVKVNAIYGLMVALLIGGFDILCITISYTMILRAVVSLSSADARQK
AFSTCTAHICAIVFSYSPAFFSFFSHRFGGHTIPPSCHIIVANIYLLLPPTMNPVVYGVK
TKQIRDCVIRILSGSKDSKAHGI