Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52n4b Olfactory Receptor

Gene Symbol Or52n4b
Organism Mouse
Family 52
Subfamily n
Pseudo No
Location chr7:108544527-108545495 (+)
Aliases Olfr503, MOR34-12, MOR34-8P

Sequence information


Nucleotide sequence

ATGGTCATGTCAGCGAGGAATAACCCAGATCTGACCCCAGCTTCCTTTGTTCTGAATGGG
ATCCCAGGCCTGGAACACATGCACATCTGGATCTCCTTCCCTTTCTGTTCCATGTATGCA
GTGGCTATGATGGGGAACTGTGGACTCCTCTATCTCATCTTCTTTGAGGATTCCTTACAC
AGACCCATGTACTACTTTTTAGCAATGCTTTCTCTAACAGACCTTGTCATGTGCTCTAGT
ACAATCCCCAAAGCCCTGTGCATCTTCTGGTTTCATCTCAAAGAAATTGGATTTGACGAC
TGTCTTGTACAGATGTTCTTCATCCATACCTTCATGGGGATGGAGTCTGGAGTGCTCATG
CTCATGGCTCTGGACCACTATGTAGCCATTTGCTACCCTCTGCATTACTCCACCATTCTC
ACCAATCCTATCATTGCCAAGATTGGGTTAGCCACCTTCCTGAGGGGCGTTCTGCTAATT
ATTCCATTCATATTTCTCTCCAAGTGCCTACCCTACTTTCGAGGCAATATAATAAACCAT
ACCTACTGTGACCACATGTCTGTAGCCAAGTTGCCCTGTGGCAATGTCAAGGTGAATGCC
ATTTATGGTCTAATGGTTGCTCTCTTGATTGGGGGTTTTGACATCCTGTGTATCACAATC
TCCTATATCATGATTCTGAGGGCAGTGGTCAGCTTATCATCAGCAGATGCTAGGCAGAAG
GCCTTCAGCACCTGCACTGCCCACATCTGTGCCATTGTTTTCTCCTATAGCCCAACCTTC
TTGTCCTTCTTTTCCCACCACTTTGGGGGGCACACAATCCCTCCATCTTGCCACATCATT
GTGGCTAATATTTATCTGCTTTTGCCTCCCACTATGAACCCTGTTGTCTATGGAGTGAAA
ACCAAACAGATACAAGACTGTGTCATAAGGATTTTTTCAGAGTCTAAGGATTCCAAAGCT
CACGGTATA


Conceptual translation

MVMSARNNPDLTPASFVLNGIPGLEHMHIWISFPFCSMYAVAMMGNCGLLYLIFFEDSLH
RPMYYFLAMLSLTDLVMCSSTIPKALCIFWFHLKEIGFDDCLVQMFFIHTFMGMESGVLM
LMALDHYVAICYPLHYSTILTNPIIAKIGLATFLRGVLLIIPFIFLSKCLPYFRGNIINH
TYCDHMSVAKLPCGNVKVNAIYGLMVALLIGGFDILCITISYIMILRAVVSLSSADARQK
AFSTCTAHICAIVFSYSPTFLSFFSHHFGGHTIPPSCHIIVANIYLLLPPTMNPVVYGVK
TKQIQDCVIRIFSESKDSKAHGI