Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or52n4c Olfactory Receptor

Gene Symbol Or52n4c
Organism Rat
Family 52
Subfamily n
Pseudo No
Location chr1:169,698,000-169,699,000 (+)
Aliases Olr163

Sequence information


Nucleotide sequence

ATGTCAGCGCAGAATAATACAGATCTGACTCCAGCTTCCTTTGTTCTGAATGGGATCCCC
GGCTTGGAAGACATGCACATCTGGATTTCCTTCCCATTCTGTTCCATGTATGCAGTGGCT
ATGATGGGCAACTGTGGACTCCTCTATCTCATCTTCTTTGAGGACTCCTTACATAGACCC
ATGTACTACTTTTTAGCAATGCTTTCTCTGACAGATCTTGTCATATGCTCCAGTACAATC
CCTAAAGCCCTCTGCATCTTCTGGTTCCATCTGAAAGAAATTGGATTTGATGACTGTCTT
GTACAGATGTTCTTTACCCATACCTTTATGGGGATGGAGTCTGGGGTGCTCATGCTCATG
GCTCTGGACCGCTACGTAGCCATCTGCTACCCTCTACGTTACTCCACCATTCTCACCAAT
GCTATCATTGCCAAGATTGGGTTTGCCACCTTCCTAAGAGGGGTGCTGCTAATTATTCCA
TTCACATTTCTCACCAAGCGCCTACCCTACTGCCGAGGCAATATAATACACCATACCTAC
TGTGACCACATGTCCGTAGCCAAGTTGTCCTGTGGCAATGTCAAGGTGAATGCCATTTAT
GGCCTGATGGTTGCTCTCTTGATTGGAGGCTTTGACATTCTGTGCATCACAGTCTCCTAC
ACCATGATCCTGAGGACAGTGGTCAGCTTATCCTCAGCAGATGCTAGGCAGAAAGCCTTC
AGCACCTGCACTGCCCACATCTGTGCCATTGTTTTCTCCTATAGCCCAGCCTTCTTTTCC
TTTTTTTCCCACCGCTTTGGGGGACAGACCATCCCTCCTTCTTGCCACATCATTGTGGCT
AATATTTATCTGCTTTTGCCTCCTACTATGAACCCTGTTGTTTATGGAGTGAAAACAAAG
CAAATACGAGACTGTGTCATAAGGATTCTTTCAGGGTCGAAGGATTTCAAAGCTCACAGT
ATA


Conceptual translation

MSAQNNTDLTPASFVLNGIPGLEDMHIWISFPFCSMYAVAMMGNCGLLYLIFFEDSLHRP
MYYFLAMLSLTDLVICSSTIPKALCIFWFHLKEIGFDDCLVQMFFTHTFMGMESGVLMLM
ALDRYVAICYPLRYSTILTNAIIAKIGFATFLRGVLLIIPFTFLTKRLPYCRGNIIHHTY
CDHMSVAKLSCGNVKVNAIYGLMVALLIGGFDILCITVSYTMILRTVVSLSSADARQKAF
STCTAHICAIVFSYSPAFFSFFSHRFGGQTIPPSCHIIVANIYLLLPPTMNPVVYGVKTK
QIRDCVIRILSGSKDFKAHSI