Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or52n5 Olfactory Receptor

Gene Symbol Or52n5
Organism Rat
Family 52
Subfamily n
Pseudo No
Location chr9:101,251,000-101,252,000 (+)
Aliases Olr177-ps

Sequence information


Nucleotide sequence

ATGCTGGTTTCCAACAACTCATATGAAGCCCCACAGTCTTTCATTCTTAATGGAATTCCT
GGTCTGGAAGCAGTGCACATATGGATCTACCTCCCACTTTGTACAATGTACATCATCTCC
CTAGTAGGCAACCTTGGTCTTGTGTACCTCATTTACTATGAGGAATCCTTACATCACCCA
ATGTACTTCTTTCTGGCCATGCTTTCTCTCATTGACCTGTTTACCTGCACAACTACTCTC
CCCAATGCTCTCTTCATTTTCTGGTTCAAACTCAAGGAAATTAACTTCACTGCTTGCCTA
GTTCAGATGTTCTTTGTGCATGGATTCACAGGTGTGGAGTCTGGGGTGCTCATGCTCATG
GCCCTGGACCGCTATGTGGCCATTTGCTACCCACTACGCTATGCTACCATACTTACCAAC
CCTGTTATTGCTAAAGCTGGACTTGCCACCTTCTTGAGAGGTGTGTTACTGATGATTCCT
TTTCCATTCTTGGTTAAACGTTTGCCCTTCTGCAAAAGCAATGTCATCTCCCATACATAC
TGTGACCACATGTCTGTTGTAAAGTTATCCTGTGCCAGCATCAAAATCAATGTCATTTAT
GGTCTCATGGTTGCACTCCTGATTGGAGTGTTTGACATTTGTTGTATATCTGTGTCCTAC
ACTATGATCCTCCGGGCAGTGGTCAGCCTGTCCTCCGCAGACGCTCGGCAGAAGGCCTTC
AGCACCTGCACAGCCCACATATCTGCTATCATCATCACTTACGTTCCAGCCTTCTTCACC
TTCTTTACTCATCGTTTTGGAGGTCACACCATCCCACCTTCTCTTCACATCATTGTGGCA
AATCTTTATCTTCTTCTTCCTCCAACTCTAAATCCCATTGTTTATGGA


Conceptual translation

MLVSNNSYEAPQSFILNGIPGLEAVHIWIYLPLCTMYIISLVGNLGLVYLIYYEESLHHP
MYFFLAMLSLIDLFTCTTTLPNALFIFWFKLKEINFTACLVQMFFVHGFTGVESGVLMLM
ALDRYVAICYPLRYATILTNPVIAKAGLATFLRGVLLMIPFPFLVKRLPFCKSNVISHTY
CDHMSVVKLSCASIKINVIYGLMVALLIGVFDICCISVSYTMILRAVVSLSSADARQKAF
STCTAHISAIIITYVPAFFTFFTHRFGGHTIPPSLHIIVANLYLLLPPTLNPIVYG