Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52p1 Olfactory Receptor

Gene Symbol Or52p1
Organism Mouse
Family 52
Subfamily p
Pseudo No
Location chr7:104,618,000-104,619,000 (+)
Aliases Olfr656

Sequence information


Nucleotide sequence

MSNTISQTMESPNHTDLDPSIFFLLGIPGLEQFHMWLSLPVCCLGTATIVGNITILVVVA
TEPTLHRPVYLFLCMLSTIDLAASFSTVPKLLAILWCGAGHISASACLTQMFFIHAFCMM
ESTVLLAMAFDRYVAICHPLRYSTILTDTIIARIGVVAMMRGSLLMLPCPFLIGRLSFCQ
SHVIPHTYCEHMAVVKLACGDTRPNRVYGLTAALLVIGVDLFCIGLSYALIAQAVFRLSS
QEARSKALGTCGSHVCVILISYTPALFSFFTHRFGHHVPLHIHILLANVYLLFPPALNPV
VYGVKTREIRERVAKVFQWGQGTRLKISK


Conceptual translation

MSNTISQTMESPNHTDLDPSIFFLLGIPGLEQFHMWLSLPVCCLGTATIVGNITILVVVA
TEPTLHRPVYLFLCMLSTIDLAASFSTVPKLLAILWCGAGHISASACLTQMFFIHAFCMM
ESTVLLAMAFDRYVAICHPLRYSTILTDTIIARIGVVAMMRGSLLMLPCPFLIGRLSFCQ
SHVIPHTYCEHMAVVKLACGDTRPNRVYGLTAALLVIGVDLFCIGLSYALIAQAVFRLSS
QEARSKALGTCGSHVCVILISYTPALFSFFTHRFGHHVPLHIHILLANVYLLFPPALNPV
VYGVKTREIRERVAKVFQWGQGTRLKISK