Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or52p1 Olfactory Receptor

Gene Symbol Or52p1
Organism Rat
Family 52
Subfamily p
Pseudo No
Location chr1:169,616,000-169,617,000 (+)
Aliases Olr157

Sequence information


Nucleotide sequence

ATGTCCATCACCACAGGCCAGACCATGGACGCTCCTAATCACACGGATCTGGATCCTTCT
ATCTTCTTTCTCTTGGGCATCCCGGGTCTAGAGCAGTTCCATATGTGGCTCTCACTTCCC
GTGTGCTGTCTGGGCACTGCCACAATCATGGGCAATATAACCATCCTGGTTGTTGTTGCC
ACGGAGCCAACCTTGCACAAACCCGTCTATCTCTTCCTATGCATGCTATCAACCATTGAT
TTGGCCGCCTCTTTCTCCACAGTACCAAAACTGCTGGCTATTCTCTGGTGTGGAGCTGGC
CATATCTCTGCCTCTGCCTGCCTGGCACAGATGTTCTTCATTCATGCCTTTTGCATGATG
GAGTCCACCGTGCTGTTGGCCATGGCCTTTGATCGCTATGTGGCCATCTGCCACCCACTC
CGCTATTCTACCATCCTCACTGACACCATCATTGCTCGCATTGGGGTAGTAGCTATGATG
AGAGGCTCCCTGCTCATGCTTCCATGTCCCTTCCTCATTGGTCGCCTGAGCTTCTGCCAA
AGCCATGTGATCCCACACACATACTGTGAGCATATGGCTGTGGTGAAGCTGGCCTGTGGA
GACACCAGGCCTAATCGTGTGTATGGGCTGACAGCTGCACTGTTGGTCATTGGGGTTGAT
TTATTCTGCATCGGTCTTTCCTATGCCCTCATTGCGCAAGCTGTTTTTCGCCTCTCATCC
CAGGAAGCCCGGTCCAAAGCCTTAGGTACCTGTGGCTCCCATGTCTGCGTCATCCTCATC
TCTTACACACCAGCCCTCTTTTCCTTTTTCACACACCGCTTTGGCCACCACGTCCCACTC
CACATTCATATTCTTTTGGCTAATGTCTATCTGCTTTTCCCACCGGCTCTTAACCCTGTG
GTATATGGAGTCAAGACCAGGGAGATTCGTGAGAGGGTTGCCAAGGTGTTTCAGTGGGGA
CAGGGAACTAGGCTGAAGATATCTAAG


Conceptual translation

MSITTGQTMDAPNHTDLDPSIFFLLGIPGLEQFHMWLSLPVCCLGTATIMGNITILVVVA
TEPTLHKPVYLFLCMLSTIDLAASFSTVPKLLAILWCGAGHISASACLAQMFFIHAFCMM
ESTVLLAMAFDRYVAICHPLRYSTILTDTIIARIGVVAMMRGSLLMLPCPFLIGRLSFCQ
SHVIPHTYCEHMAVVKLACGDTRPNRVYGLTAALLVIGVDLFCIGLSYALIAQAVFRLSS
QEARSKALGTCGSHVCVILISYTPALFSFFTHRFGHHVPLHIHILLANVYLLFPPALNPV
VYGVKTREIRERVAKVFQWGQGTRLKISK