Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52p2 Olfactory Receptor

Gene Symbol Or52p2
Organism Mouse
Family 52
Subfamily p
Pseudo No
Location chr7:102,588,000-102,589,000 (-)
Aliases Olfr551

Sequence information


Nucleotide sequence

MQHTNHSHQNPSSFLLMGIPGLEASHFWIAFPFCSMYALAVLGNMAVLLVVRSEPSLHQP
MYLFLCMLSTIDLILCTSTVPKLLALFWANAAEIAFGACATQMFFIHGFSAVESGILLSM
AFDRYLAICRPLHYGSLLSSESVSKLGAAALLRGLGLMTPLTCLLARLSYCGRVVAHSYC
EHMAVVKLACGGTQPNNIYGITAATLVVGTDSICIAISYALILRAVLGLSSKEARAKTFG
TCGSHLGVILLFYTPGLFSFYTQRFGQHVPRHVHILLADLYLVVPPMLNPIIYGMKTKQI
RDGALRLLKRGPAQS


Conceptual translation

MQHTNHSHQNPSSFLLMGIPGLEASHFWIAFPFCSMYALAVLGNMAVLLVVRSEPSLHQP
MYLFLCMLSTIDLILCTSTVPKLLALFWANAAEIAFGACATQMFFIHGFSAVESGILLSM
AFDRYLAICRPLHYGSLLSSESVSKLGAAALLRGLGLMTPLTCLLARLSYCGRVVAHSYC
EHMAVVKLACGGTQPNNIYGITAATLVVGTDSICIAISYALILRAVLGLSSKEARAKTFG
TCGSHLGVILLFYTPGLFSFYTQRFGQHVPRHVHILLADLYLVVPPMLNPIIYGMKTKQI
RDGALRLLKRGPAQS