Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or52p2 Olfactory Receptor

Gene Symbol Or52p2
Organism Rat
Family 52
Subfamily p
Pseudo No
Location chr1:167,732,000-167,733,000 (-)
Aliases Olr44

Sequence information


Nucleotide sequence

ATGCTAACCCATGTCCTGCTTTGTACATTTCCCAGGGCCTTACAATCTTCTCATCCCAGA
TGCTCTTTTGTGGAGTTTAACTCAAATGCTTCTGCTACCGTTAAGCTACAGCACAAAGAT
GATCCCAGCTGCCCCATCCCTTTAAGGCTTCATAGAGTTCAGAGCTTAGATCTTCCGCAC
AGACTCTTCCTCAGCTTGACCATGCAACACACGAACCACAGCCATCAGAACCCAAGCTCC
TTCCTGCTCATGGGGATTCCCGGCCTGGAGGCAGCCCACTTTTGGATTGCATTTCCTTTC
TGTTCCATGTATGCCCTAGCAGTTCTTGGCAACATGGCAGTCCTGCTGGTGGTGCGCTCT
GAGCCTTCACTGCACCAGCCCATGTACCTGTTCCTGTGCATGCTGTCCACTATTGACCTG
ATACTCTGCACCTCCACTGTCCCCAAACTCCTCGCACTCTTTTGGGCAAATGCAGCTGAG
ATTGCCTTTGGGGCCTGTGCTGCCCAGATGTTCTTTATCCATGGCTTCTCAGCTGTAGAA
TCTGGCATCCTGTTATCAATGGCCTTTGATCGATACTTGGCCATCTGCCGGCCACTGCAC
TATGGGTCACTGCTGTCCGCAGAGTCAGTGAGCAAGTTAGGGGCTGCTGCTCTGCTCCGT
GGCCTGGGGCTCATGACCCCACTCACTTGCCTACTGGCAAGGCTGAGCTACTGTGGCCGT
GTGGTAGCACACTCCTACTGTGAGCACATGGCTGTGGTGAAGCTGGCTTGTGGGGGCACC
CAACCAAACAATATATATGGCATCACAGCAGCCACACTAGTTGTAGGAACTGACTCCATT
TGTATTGCTGTATCCTATGCACTCATCCTCCGGGCTGTGTTGGGCCTCTCCTCCAAAGAA
GCTAGGGCAAAGACCTTTGGCACTTGTGGCTCCCACCTGGGCGTCATCCTTCTCTTCTAC
ACACCAGGGCTCTTCTCATTCTATACGCAGCGTTTCGGTCAACACGTACCCAGGCACGTC
CACATCCTCCTGGCTGACCTCTACCTGGTTGTACCACCCATGCTCAACCCCATCATCTAT
GGGATGAAAACCAAGCAGATCAGAGACGGAGCACTCCGACTACTCAAGAGGGGCCCTGCA
CAATCA


Conceptual translation

MLTHVLLCTFPRALQSSHPRCSFVEFNSNASATVKLQHKDDPSCPIPLRLHRVQSLDLPH
RLFLSLTMQHTNHSHQNPSSFLLMGIPGLEAAHFWIAFPFCSMYALAVLGNMAVLLVVRS
EPSLHQPMYLFLCMLSTIDLILCTSTVPKLLALFWANAAEIAFGACAAQMFFIHGFSAVE
SGILLSMAFDRYLAICRPLHYGSLLSAESVSKLGAAALLRGLGLMTPLTCLLARLSYCGR
VVAHSYCEHMAVVKLACGGTQPNNIYGITAATLVVGTDSICIAVSYALILRAVLGLSSKE
ARAKTFGTCGSHLGVILLFYTPGLFSFYTQRFGQHVPRHVHILLADLYLVVPPMLNPIIY
GMKTKQIRDGALRLLKRGPAQS