Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52r1 Olfactory Receptor

Gene Symbol Or52r1
Organism Mouse
Family 52
Subfamily r
Pseudo No
Location chr7:102,887,000-102,888,000 (-)
Aliases Olfr569

Sequence information


Nucleotide sequence

MVASSNSSSHPLFFMLLGIPGLENYQFWIAFPFCVMYIVALTGNITILYIIRIDHTLHEP
MYLFLALLAITDLVLSSSTQPKMLAILWFHSHEIEYNACLIQVFFIHAFSSVESGVLMTM
ALDRYVAICFPLRHSSILTTSVVIKLGAAVMVRGLLWVSPFCFMVSRMPFCPNKVIPQSY
CEHMAVLKLVCADTRVNRGYGLFVAFSVVGFDIIVISVSYVMILRAVLRLPSGEARLKAF
GTCASHVCVILAFYIPALFTFLTHRFGHHVPRVVHIMFANFYLLVPPMLNPIIYGVRTKQ
IRDRVIRGFRRKDP


Conceptual translation

MVASSNSSSHPLFFMLLGIPGLENYQFWIAFPFCVMYIVALTGNITILYIIRIDHTLHEP
MYLFLALLAITDLVLSSSTQPKMLAILWFHSHEIEYNACLIQVFFIHAFSSVESGVLMTM
ALDRYVAICFPLRHSSILTTSVVIKLGAAVMVRGLLWVSPFCFMVSRMPFCPNKVIPQSY
CEHMAVLKLVCADTRVNRGYGLFVAFSVVGFDIIVISVSYVMILRAVLRLPSGEARLKAF
GTCASHVCVILAFYIPALFTFLTHRFGHHVPRVVHIMFANFYLLVPPMLNPIIYGVRTKQ
IRDRVIRGFRRKDP