Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or52r1 Olfactory Receptor

Gene Symbol Or52r1
Organism Rat
Family 52
Subfamily r
Pseudo No
Location chr1:168,014,000-168,015,000 (-)
Aliases Olr50

Sequence information


Nucleotide sequence

ATGGTAGCTTCAAGTAACAGCTCTTCCCATCCTCTGTTCTTTATCTTGCTTGGAATCCCA
GGACTGGAGAATTATCAGTTTTGGATCGCCTTTCCTTTCTGTGTTATGTATATTGTGGCA
CTGACTGGAAATATCACCATCCTATACATAATCCAAACTGACCACACCTTGCATGAGCCC
ATGTACCTCTTCCTAGCCCTGCTGGGTATCACTGATCTGGTTCTATCCTCCTCCACACAA
CCTAAAATGCTGGCCATACTCTGGTTTCACGATCATGAGATTGAATACAATGCCTGCCTC
ATCCAGGTATTCTTCATTCATGCCTTTTCTTCTGTGGAGTCTGGGGTGCTCATGGCCATG
GCCTTGGACCGCTATGTGGCTATCTGTTTCCCACTCAGACACTCCAGCATCCTGACCACA
TCTGTAGTCATCAAACTAGGGGCAGCTGTGATGGTGAGAGGGCTGCTGTGGGTGAGCCCC
TTCTGCTTCATGATCTCCAGGATGCCCTTCTGCCCCAACAACGTCATTCCCCAGTCCTAC
TGTGAGCACATGGCTGTGCTCAAGTTGGTATGTGCTGATACCAGAGTTAATCGTGGATAT
GGACTCTTTGTGGCTTTCTCTGTGGTTGGCTTTGACATAATTGTCATCAGTGTATCTTAT
GTGATGATTCTGAGAGCTGTGTTGAGGTTGCCCTCTGGCGAAGCTCGCCTCAAAGCTTTT
GGTACATGTGCTTCCCATGTCTGTGTTATCTTGGCTTTCTATATCCCAGCCCTTTTCACC
TTCCTCACCCACCGCTTTGGCCACCATGTGCCCCGTGTTGTGCACATTATATTTGCTAAT
TTCTATCTGCTGGTTCCTCCCATGCTCAACCCTATTGTCTACGGAGTCAGAACCAAACAG
ATCCGGGACAGGGTTATCCGAGGATTCAGGAGAAAAAAACTTGAGCCAGGGATCACAGTA
GCTCCAGGTCAA


Conceptual translation

MVASSNSSSHPLFFILLGIPGLENYQFWIAFPFCVMYIVALTGNITILYIIQTDHTLHEP
MYLFLALLGITDLVLSSSTQPKMLAILWFHDHEIEYNACLIQVFFIHAFSSVESGVLMAM
ALDRYVAICFPLRHSSILTTSVVIKLGAAVMVRGLLWVSPFCFMISRMPFCPNNVIPQSY
CEHMAVLKLVCADTRVNRGYGLFVAFSVVGFDIIVISVSYVMILRAVLRLPSGEARLKAF
GTCASHVCVILAFYIPALFTFLTHRFGHHVPRVVHIIFANFYLLVPPMLNPIVYGVRTKQ
IRDRVIRGFRRKKLEPGITVAPGQ