Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52r1b Olfactory Receptor

Gene Symbol Or52r1b
Organism Mouse
Family 52
Subfamily r
Pseudo No
Location chr7:103,041,000-103,042,000 (+)
Aliases Olfr582

Sequence information


Nucleotide sequence

MMHSLMLASRNNSSHSTFFILLGIPGLENYQFWVAFPFCVMYIVAVTGNITILHIIRIDH
TLHEPMYLFLAMLATTDLVLSSSTQPKMLAILWFHDHKIEYHACLIQVFFIHAFSSVESG
VLMDMALDRYVAICFPLRHSSILTTSVVIKLGVAVMVRGLLWVSPFCFMVSRMPFCPNKV
IPQSYCEHMAVLKLVCADTRVNRGYGLFVAFSVAVFDLAVISVSYAMILRAVLRLPSGEA
RLKAFGTCASHIGVILTLYIPALFTFLTHRFGHHVPRIVHIMFANVYLLVPPMLNPIIYG
VRTKQIRDRVTQAFCGKGS


Conceptual translation

MMHSLMLASRNNSSHSTFFILLGIPGLENYQFWVAFPFCVMYIVAVTGNITILHIIRIDH
TLHEPMYLFLAMLATTDLVLSSSTQPKMLAILWFHDHKIEYHACLIQVFFIHAFSSVESG
VLMDMALDRYVAICFPLRHSSILTTSVVIKLGVAVMVRGLLWVSPFCFMVSRMPFCPNKV
IPQSYCEHMAVLKLVCADTRVNRGYGLFVAFSVAVFDLAVISVSYAMILRAVLRLPSGEA
RLKAFGTCASHIGVILTLYIPALFTFLTHRFGHHVPRIVHIMFANVYLLVPPMLNPIIYG
VRTKQIRDRVTQAFCGKGS