Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52r1c Olfactory Receptor

Gene Symbol Or52r1c
Organism Mouse
Family 52
Subfamily r
Pseudo No
Location chr7:103,086,000-103,086,000 (+)
Aliases Olfr584

Sequence information


Nucleotide sequence

MMYSLMLASRNSSSHSTFFILLGIPGLENYQFWVAFPFCVMYIVAVTGNITILHIIRIDH
TLHEPMYLFLAMLATTDLVLSSSTQPKMLAILWFHDHKIEYHACLIQVFFIHAFSSVESG
VLMTMALDRYVAICFPLRHSSILTTSAVIKLGAVVMVRGLLWVSPFCFMVSRMPFCPNKI
IPQSYCEHMAVLKLVCADTRVNRGYGLFVAFSVVGFDIIVISVSYVMILRAVLRLPSGEA
RLKAFGTCASHIGVILTLYIPALFTFLTHRFGHHVPRVVHIMFANVYLLVPPMLNPIIYG
VRTKQIRDRVTRGFCVKGS


Conceptual translation

MMYSLMLASRNSSSHSTFFILLGIPGLENYQFWVAFPFCVMYIVAVTGNITILHIIRIDH
TLHEPMYLFLAMLATTDLVLSSSTQPKMLAILWFHDHKIEYHACLIQVFFIHAFSSVESG
VLMTMALDRYVAICFPLRHSSILTTSAVIKLGAVVMVRGLLWVSPFCFMVSRMPFCPNKI
IPQSYCEHMAVLKLVCADTRVNRGYGLFVAFSVVGFDIIVISVSYVMILRAVLRLPSGEA
RLKAFGTCASHIGVILTLYIPALFTFLTHRFGHHVPRVVHIMFANVYLLVPPMLNPIIYG
VRTKQIRDRVTRGFCVKGS