Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52s1 Olfactory Receptor

Gene Symbol Or52s1
Organism Mouse
Family 52
Subfamily s
Pseudo No
Location chr7:103,212,000-103,213,000 (+)
Aliases Olfr593

Sequence information


Nucleotide sequence

MKRKLRHLTVVMSIYNKSDVHPSTFILIGIPGLEAAHMWISIPFCMVYVLALMGNSSLLF
IIKTDSSLHEPMYLFLCMLAVADLVVCTTAVPKLLSLFWFHDGEIRFEACLTQIFLIHSC
STMESGFFLAMAFDRYVAICNPLRHSAILTHTVTGGIGLAVVIRGIALLSPHPFLLRWLP
YCKTNIISHTYCEFMALIKIACAETSIRRAYSLIVAFLTGGVDFILIICSYVLILNTVFH
LPTKDARLKTLGTCGSHVCVILVSYTPAFFSFLTHRFGHKVAPQVHIFVANIYLLVPPMV
NPIIYGVRTKKIRNRFLKVFRFSKHTN


Conceptual translation

MKRKLRHLTVVMSIYNKSDVHPSTFILIGIPGLEAAHMWISIPFCMVYVLALMGNSSLLF
IIKTDSSLHEPMYLFLCMLAVADLVVCTTAVPKLLSLFWFHDGEIRFEACLTQIFLIHSC
STMESGFFLAMAFDRYVAICNPLRHSAILTHTVTGGIGLAVVIRGIALLSPHPFLLRWLP
YCKTNIISHTYCEFMALIKIACAETSIRRAYSLIVAFLTGGVDFILIICSYVLILNTVFH
LPTKDARLKTLGTCGSHVCVILVSYTPAFFSFLTHRFGHKVAPQVHIFVANIYLLVPPMV
NPIIYGVRTKKIRNRFLKVFRFSKHTN