Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or52s6 Olfactory Receptor

Gene Symbol Or52s6
Organism Rat
Family 52
Subfamily s
Pseudo No
Location chr1:168,478,000-168,479,000 (-)
Aliases Olr95

Sequence information


Nucleotide sequence

ATGCACTCTATACAAAAACTTCAGCCACAAACAGTGGGTAGTGCCACCATGGGGCCAGCT
AATGAGTCGCAATTCTCTCCAAGCACCTTCTGGCTGATGGGCATCCCTGGCCTAGAACAC
CTCCATGTCTGGATTGGGATTCCCTTCTGCTCCATGTACATGGTGGCCCTGATGGGAAAT
GTAACTATTCTGGCTGTGGTGAGAGCAGAGCGCAGCCTCCATGAGCCCATGTTCCTTTTC
CTGTGCATGCTGTCAATCACTGACCTGGTCCTCTCCACATCAACATTGCCACGCATGCTC
TGTCTTTTCTGGATGGCAGCCCATGATATCACCTTCGATGCATGTCTTGCTCAAATGTTC
TTCATCCACAGTTTCACTGCCATGGAATCTGGCTTTTTCTTGGCCATGGCCATTGATCGC
TATGTAGCCATCTGTGACCCATTACGTCATACCACTATTCTCACCAACAGTCGCATCGCC
AAGATGGGAGCAGTTGTGGTGCTGCGGGGAGTAGGCTTCTTCTCCCCACACCCCATACTG
CTCAAGCAGCTGCCCTACTGCAGAACTCGAATCATTGCACATACCTACTGTGAGTTCATG
GCTGTGGTGAAGCTAGCATGTGTGGACACAGGAGCCACCAAACGTTACAGCCTTAGTGTG
GCCTCTGTCATTGGTTCTTGTGATGGTTTCTTCATTGCCCTTTCCTACGTTCTTATCCTC
CGTGCTGTTTTTCGTCTTCCATCTCGAGAAGCAAGTCTTAAAGCCTTAGGCACCTGTGGC
TCCCATGTCTGTGTAATCCTTGTTTTCTATTCTACAGCTGTCTTTACATTCCTGACCCAC
CGTTTTGGCCACAATGTGGCCCCCCAAATTCATATCTTTATAGCTAATATGTACCTTCTG
GTACCACCTTTTCTAAACCCCATTGTTTATGGTATTAGGACAAAGAAAATTAGAGAATAT
GTTCTTAGTTTTCTTAGAATAAAAGTTTCC


Conceptual translation

MHSIQKLQPQTVGSATMGPANESQFSPSTFWLMGIPGLEHLHVWIGIPFCSMYMVALMGN
VTILAVVRAERSLHEPMFLFLCMLSITDLVLSTSTLPRMLCLFWMAAHDITFDACLAQMF
FIHSFTAMESGFFLAMAIDRYVAICDPLRHTTILTNSRIAKMGAVVVLRGVGFFSPHPIL
LKQLPYCRTRIIAHTYCEFMAVVKLACVDTGATKRYSLSVASVIGSCDGFFIALSYVLIL
RAVFRLPSREASLKALGTCGSHVCVILVFYSTAVFTFLTHRFGHNVAPQIHIFIANMYLL
VPPFLNPIVYGIRTKKIREYVLSFLRIKVS