Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52u1 Olfactory Receptor

Gene Symbol Or52u1
Organism Mouse
Family 52
Subfamily u
Pseudo No
Location chr7:104,588,000-104,589,000 (+)
Aliases Olfr654

Sequence information


Nucleotide sequence

MQVVSLLLPSGTLPGSTMMPCNSTSHPSFFILQGIPGMEDKHKWISIPFSSMYFITVMGN
CTILLTISMERSLHKPMFLLLFFLALTDLGMSTTTIPKVLCIFWFGQSQISYEGCLVQLF
FIHSISAMQSSVLMTMAFDRYVAICKPLRYSTILSNSRIGLIGLASLVRAILFILPMPIL
LQRMPFHANRVIPTTYCEHMAVVKMVCVDTTFNRIYGLVVAMLVVGVDISAIASSYALIL
RAIMHLSSKEAHHKAVNTCTTHICVMLVSYTPSLFSFLTHRFGRGIPPHVHTILGNLYFL
VPPMLNPIIYGVKTKEFRDKITKYLYRRKEPIIFSHNQKLV


Conceptual translation

MQVVSLLLPSGTLPGSTMMPCNSTSHPSFFILQGIPGMEDKHKWISIPFSSMYFITVMGN
CTILLTISMERSLHKPMFLLLFFLALTDLGMSTTTIPKVLCIFWFGQSQISYEGCLVQLF
FIHSISAMQSSVLMTMAFDRYVAICKPLRYSTILSNSRIGLIGLASLVRAILFILPMPIL
LQRMPFHANRVIPTTYCEHMAVVKMVCVDTTFNRIYGLVVAMLVVGVDISAIASSYALIL
RAIMHLSSKEAHHKAVNTCTTHICVMLVSYTPSLFSFLTHRFGRGIPPHVHTILGNLYFL
VPPMLNPIIYGVKTKEFRDKITKYLYRRKEPIIFSHNQKLV