Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or52u1 Olfactory Receptor

Gene Symbol Or52u1
Organism Rat
Family 52
Subfamily u
Pseudo No
Location chr1:169,590,000-169,591,000 (+)
Aliases Olr155

Sequence information


Nucleotide sequence

ATGCCTTGCAACAGCACCAGCCACCCTTCTTTCTTCATTCTCCAAGGCATTCCTGGGATG
GAAGACAAACACAGATGGATCTCCATCCCCTTCTCCTCCATGTACTTAATCACCGTGATG
GGGAACTGCACCATTCTTCTCACCATCTCCATGGAGCGCTCCCTGCACAAGCCCATGTTC
CTGCTTCTCTTCCTCCTGGCTCTCACAGACTTGGGTATGTCGACGACCACCATTCCTAAG
GTGCTCTGCATATTCTGGTTTGGACAGAGTCAGATAAGCTATGAAGGCTGCTTGGCTCAG
CTCTTCTTCATCCATTCCATCTCCGCCATGCAGTCATCTGTCCTGATGACCATGGCTTTT
GACCGTTATGTGGCTATCTGTAAGCCCTTGCGCTACTCCACCATTCTTTCCAATAGTCGC
ATTGGGCTCATTGGCTTAGCGGGTCTGGTACGAGCAATCCTCTTTATTCTCCCCATGCCT
ATCCTCCTCCAGCATATGCCTTTTCATGCCAATCGAGTCATCCCCACAACCTACTGTGAG
CACATGGCTGTGGTGAAGATGGTATGTGTCGATACCACAGTCAATAGGATATATGGTTTG
GTCGTGGCCATGCTGGTGGTTGGGGTGGACATCTCAGCTATTGCCTCATCTTATGTGCTA
ATCCTACGAGCTATCATGCATCTGTCTTCCAAGGAAGCCCACCACAAAGCAGTCAACACC
TGCACCACACACATCTGCGTCATGCTCGTCTCCTATACCCCCAGTCTTTTCTCTTTTCTG
ACTCATCGCTTTGGAAGAGGCATTCCACCTCATATCCACACTATTCTTGGCAACCTCTAC
TTCCTTGTACCACCCATGCTCAATCCTATCATTTATGGTGTAAAAACCAAGGAATTTCGG
GACAAAGTTACCAAATATTTATACAGGAGGAAGGAGCCTATAATTTTTTCTCACAATCAG
AAACTTGCT


Conceptual translation

MPCNSTSHPSFFILQGIPGMEDKHRWISIPFSSMYLITVMGNCTILLTISMERSLHKPMF
LLLFLLALTDLGMSTTTIPKVLCIFWFGQSQISYEGCLAQLFFIHSISAMQSSVLMTMAF
DRYVAICKPLRYSTILSNSRIGLIGLAGLVRAILFILPMPILLQHMPFHANRVIPTTYCE
HMAVVKMVCVDTTVNRIYGLVVAMLVVGVDISAIASSYVLILRAIMHLSSKEAHHKAVNT
CTTHICVMLVSYTPSLFSFLTHRFGRGIPPHIHTILGNLYFLVPPMLNPIIYGVKTKEFR
DKVTKYLYRRKEPIIFSHNQKLA