Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52w1 Olfactory Receptor

Gene Symbol Or52w1
Organism Mouse
Family 52
Subfamily w
Pseudo No
Location chr7:105,368,000-105,369,000 (+)
Aliases Olfr692

Sequence information


Nucleotide sequence

MRPKLHPYRMAESSQSNSTFQHPAFFILTGIPALGDGQAWLSLVFGLMYLLALLGNATLL
TVIRIDSTLHQPMFLLLATLAATDLGLATSIAPELLAVLWLGPQPVQYTACLIQMFFVHA
LTAMESGVLLAMACDRAVAVGRPLHYPILVTKARVGYAVLALTLKVLAVIVPFPLLVVRF
KHFHAKIIHHAYCAHMAVVELVVGNTWVNNMYGLALSLAVSGVDILGIAGSYGLIAHAVL
RLPTQEARVKAFGTCSSHICVILAFYVPGLFSFLTHRFGRHTVPKPVHILLSIIYLLLPP
ALNPLIYGVRTKQIRDRFLEMFKFRKKQF


Conceptual translation

MRPKLHPYRMAESSQSNSTFQHPAFFILTGIPALGDGQAWLSLVFGLMYLLALLGNATLL
TVIRIDSTLHQPMFLLLATLAATDLGLATSIAPELLAVLWLGPQPVQYTACLIQMFFVHA
LTAMESGVLLAMACDRAVAVGRPLHYPILVTKARVGYAVLALTLKVLAVIVPFPLLVVRF
KHFHAKIIHHAYCAHMAVVELVVGNTWVNNMYGLALSLAVSGVDILGIAGSYGLIAHAVL
RLPTQEARVKAFGTCSSHICVILAFYVPGLFSFLTHRFGRHTVPKPVHILLSIIYLLLPP
ALNPLIYGVRTKQIRDRFLEMFKFRKKQF