Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52x1 Olfactory Receptor

Gene Symbol Or52x1
Organism Mouse
Family 52
Subfamily x
Pseudo No
Location chr7:105,203,000-105,204,000 (-)
Aliases Olfr686

Sequence information


Nucleotide sequence

MIFSNNSHLLPHTFFLTGIPGLTAAHVWISLPFCFMFVLSLTGNAVLLSLIWIEHRLHQP
MFLFLAMLSFVDLVLSLSTLPKMLAIFWFGATAISSYACLSQMFLIHAFSAMESGVLVAM
ALDRFVAICNPLHYATILTPEVVAKIGGLVALRGVGLTIFFPSLACRLSYCGSHTIAYTY
CEHMSVVKLACGAITVDSLYAFAVAIFLGVGDMAFIAYSYGQIVKTVMRFPSPEARGKAG
STCTAHVCVILFFYGPGFLSVVMQRFGPSTASAAKVILANLYLLFPPALDPIVYGVKTKQ
IRECLFTIIGSKKIEPT


Conceptual translation

MIFSNNSHLLPHTFFLTGIPGLTAAHVWISLPFCFMFVLSLTGNAVLLSLIWIEHRLHQP
MFLFLAMLSFVDLVLSLSTLPKMLAIFWFGATAISSYACLSQMFLIHAFSAMESGVLVAM
ALDRFVAICNPLHYATILTPEVVAKIGGLVALRGVGLTIFFPSLACRLSYCGSHTIAYTY
CEHMSVVKLACGAITVDSLYAFAVAIFLGVGDMAFIAYSYGQIVKTVMRFPSPEARGKAG
STCTAHVCVILFFYGPGFLSVVMQRFGPSTASAAKVILANLYLLFPPALDPIVYGVKTKQ
IRECLFTIIGSKKIEPT