Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or52x1 Olfactory Receptor

Gene Symbol Or52x1
Organism Rat
Family 52
Subfamily x
Pseudo No
Location chr1:170,091,000-170,092,000 (-)
Aliases Olr197

Sequence information


Nucleotide sequence

ATGACTTTTTCCAATAATTCTCTTCTTCTTCCACATACTTTCTTCTTGACTGGCATCCCA
GGACTGACTGCTGCTCATGTTTGGATATCCCTTCCCTTCTGCTTCATGTTTGTCCTGTCA
CTAACTGGGAATGCCGTCCTGCTTTCTCTCATCTGGAAAGAACACAGGCTCCATCAGCCC
ATGTTTTTGTTTCTTGCAATGCTTTCTTTTGTTGACCTGGTCCTCTCCCTCTCCACGCTG
CCCAAGATGCTAGCTATTTTCTGGTTTGGTGCCACAGCCATCAGCTCCTATGCTTGTCTG
TCCCAAATGTTTCTCATCCATGCATTCTCTGCCATGGAGTCAGGGGTGCTGGTGGCCATG
GCCTTGGATCGCTTTGTGGCTATCTGCAACCCATTGCATTATGCAACCATCCTTACCCTT
GAGGTTGTTGCCAAGATTGGAGGCCTAGTGGCACTGCGAGGTGTGGGTTTAACCATCTTC
TTTCCGAGCCTGGCCTGTCGACTGTCTTTCTGTGCTTCGCACACAATTGCTTACACTTAC
TGTGAGCACATGTCAGTGGTGAAGCTGGCTTGCGGGGCCACAACTGTGGATAGTCTCTAT
GCTTTTGCTGTGGCAATCTTTCTTGGTGTGGGGGATGTGGCCTTTATTGCATACTCTTAT
GGACAGATTGTGAAGACAGTGATGCGTTTTCCTTCCCCTGAGGCACGTGGCAAAGCAGGA
AGCACATGCACAGCCCATGTCTGCGTCATCCTCTTCTTTTATGGACCTGGCTTTCTTTCT
GTGGTCATGCAGCGCTTTGGGCCATCCACAGCCTCTGCTGCCAAGGTCATTCTTGCCAAT
CTCTACTTGCTTTTCCCCCCTGCTTTGGACCCCATCGTATATGGGATTAAGACCAAGCAG
ATCAGAGAGTGTCTGTTAACAATTATAGGCTCCAAGAAGATTGAACCCTCT


Conceptual translation

MTFSNNSLLLPHTFFLTGIPGLTAAHVWISLPFCFMFVLSLTGNAVLLSLIWKEHRLHQP
MFLFLAMLSFVDLVLSLSTLPKMLAIFWFGATAISSYACLSQMFLIHAFSAMESGVLVAM
ALDRFVAICNPLHYATILTLEVVAKIGGLVALRGVGLTIFFPSLACRLSFCASHTIAYTY
CEHMSVVKLACGATTVDSLYAFAVAIFLGVGDVAFIAYSYGQIVKTVMRFPSPEARGKAG
STCTAHVCVILFFYGPGFLSVVMQRFGPSTASAAKVILANLYLLFPPALDPIVYGIKTKQ
IRECLLTIIGSKKIEPS