Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or52x1b-ps Olfactory Receptor

Gene Symbol Or52x1b-ps
Organism Rat
Family 52
Subfamily x
Pseudo Yes
Location chr1:170,044,000-170,046,000 (-)
Aliases Olr195-ps

Sequence information


Conceptual translation

MTFSNNSLLLPHTFFLTGIPGLTAAHVWISLPFCFMFVLSLTGNAVLLSLIWKEHRLHWP
MILVLAMLSFVDLSFPSPLCPRCWQFSGLVPQLSSL\CLSQMFLIHAFSAMESEVLLTM
ALDPFVAICNPLHYATILTPEVVAKIGGLVALRGVGLTIFFLSLACRLPYWEHISVVKLA
CRATTVTSLYAFAVAIFLGVGDVAFIAYSYG*IVKTVMHFPSPEARGKAGSTCIAHVCVI
LFYGPGFLSVVMQHFGPSTASAAKVILANLYLLFPPA*DPIVYGIKTKLIRECLLTVVGS
KKIEPT