Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or52z1 Olfactory Receptor

Gene Symbol Or52z1
Organism Rat
Family 52
Subfamily z
Pseudo No
Location chr1:168,930,000-168,931,000 (-)
Aliases Olr128

Sequence information


Nucleotide sequence

ATGAAGGTGGTCTCTTTCTTTCACAATCACACCAATCCACAGGACGTGTGGTATGTTCTG
ATTGGAATCCCAGGACTGGAAGATCTACACACCTGGATAGCAATCCCCATCTGTTCTATG
TACATTGTGGCTGTCATAGGCAATGTCCTCCTGATCTTCCTGATAATGACTGAACGTAGT
CTCCATGAGCCCATGTATTTTTTTCTCTCCATGCTGGCATTAGCAGACCTTCTGCTCTCC
ACAGCTACAGCCCCCAAGATGCTGGCTGTCTTCTGGTTACATTCCAGGGGTATTTCCTTT
GGTAGTTGTGTGACCCAAATGTTCTTCATACATTTCATCTTTGTGGCAGAGTCTGCTATT
CTTCTGGCCATGGCATTTGACCGCTATGTGGCCATCTGTTACCCACTGAGATACACCACC
ATCCTTACTTCTTCAGTCATTGGCAAGATTGGCACTGCAGCTGTGGCCAGAAGCTTTCTC
ATCTGTGGTCCATTCATCTTCCTTGTATATCGACTTCTGTATTGTGGGAGATACATAATT
CCCCATTCATACTGTGAGCACATGGGCATTGCCAGATTGGCATGTGACGATATCACTGTC
AACATCATATATGGGCTCACTATGGCTCTCCTGTCTACAGGACTGGATATAGTACTCATT
ATTATTTCCTACACCATGATCCTTCGCACTGTTTTTCAAATCCCTTCTTGGGCTGCCAGA
TATAAGGCCCTGAACACATGTGGCTCCCACATCTGTGTTATTCTTTTGTTCTACACACCT
GCATTCTTTTCATTTTTTGCCCATCGCTTTGGAGGCAAAACCATTCCTCGCCACATCCAC
ATCCTAGTGGCCAACCTCTATGTGGTGGTGCCCCCAATGCTTAATCCCATCATTTATGGG
GTAAAGACCAAGCATATCCAAGATCGAGTGGTTTTCCTTTTCTCCTCAGTGAGTACATGC


Conceptual translation

MKVVSFFHNHTNPQDVWYVLIGIPGLEDLHTWIAIPICSMYIVAVIGNVLLIFLIMTERS
LHEPMYFFLSMLALADLLLSTATAPKMLAVFWLHSRGISFGSCVTQMFFIHFIFVAESAI
LLAMAFDRYVAICYPLRYTTILTSSVIGKIGTAAVARSFLICGPFIFLVYRLLYCGRYII
PHSYCEHMGIARLACDDITVNIIYGLTMALLSTGLDIVLIIISYTMILRTVFQIPSWAAR
YKALNTCGSHICVILLFYTPAFFSFFAHRFGGKTIPRHIHILVANLYVVVPPMLNPIIYG
VKTKHIQDRVVFLFSSVSTC