Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52z14 Olfactory Receptor

Gene Symbol Or52z14
Organism Mouse
Family 52
Subfamily z
Pseudo No
Location chr7:103603656-103604615 (+)
Aliases Olfr619, MOR31-5

Sequence information


Nucleotide sequence

ATGACATCATCAACATATTTAAATCACACCATTCTCAGAGACATCTGGTACACTATGATT
GGGATCCCAGGACTAGAAGATGCACACATTTGGCTCTCCATCCCCATCTTTTCTATGTAT
ATAGTAGCTGTTATAGGCAATACATTCCTAATATTGCTGATCTCTATTGAGCATAGTCTT
CATGAACCCATGTACTTTTTCCTAACTATGTTGGCCCTGGCCGATATCTTCTTGTCCACA
GTGACCATTCCAAAGGTATTAGCAATTTTCTGGTTCCAAGATAGAAGCATTTCTTTTGCT
AGCTGTGTGTCTCAGATGTTTTTCCTCCACTTCATCTTTGTGACAGAGTCTGGTATACTA
CTCTCCATGGCATTTGACCGTTATGTTGCTATCTGCTATCCACTAAGATACACCACCATT
CTAACCCCATCTGTCATCATCAAAATGGGCATTGCAGCTGTGACTAGAAGTTTTTTCATC
TGCTTCCCCCTGATCTTTCTTGTCTATAGGCTCACCTATTGTGGGAAGAGCATCATTCGT
CACTCATACTGTGAACACATGGGCATTGCCAGGTTGGCCTGTGACAGCATCAAAGTCAAT
ATTTACTATGGATTGATTGTAGCTCTATTTTCCATATTTCTAGACGTAGTACTTATTATT
GTCTCATATGCTCGCATACTTTGTGCTGTGTACAGAATACCTTCCCAAGATACCAGACTC
AAAGCTCTGAGTACATGTGGCTCCCATGTCTGTGTCATCCTGTTATTTTATATGCCAGTT
TTCTTTTCTTCTCTTGGTCACCGTTTTGGAGGTGACAGCATACCACTGCATGTTCACATC
CTCCTTGCTAACCTCTATGTTGTTCTACCACCCTCCCTCAATCCCATCATTTATGGAGTA
AAGACCAAGCAAATTCAGGAGAGAGTTGTTCAGTTATTTTCTTTAAACAAGGTAATTTGT


Conceptual translation

MTSSTYLNHTILRDIWYTMIGIPGLEDAHIWLSIPIFSMYIVAVIGNTFLILLISIEHSL
HEPMYFFLTMLALADIFLSTVTIPKVLAIFWFQDRSISFASCVSQMFFLHFIFVTESGIL
LSMAFDRYVAICYPLRYTTILTPSVIIKMGIAAVTRSFFICFPLIFLVYRLTYCGKSIIR
HSYCEHMGIARLACDSIKVNIYYGLIVALFSIFLDVVLIIVSYARILCAVYRIPSQDTRL
KALSTCGSHVCVILLFYMPVFFSSLGHRFGGDSIPLHVHILLANLYVVLPPSLNPIIYGV
KTKQIQERVVQLFSLNKVIC