Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or52z15-ps Olfactory Receptor

Gene Symbol Or52z15-ps
Organism Rat
Family 52
Subfamily z
Pseudo Yes
Location chr1:168780031-168780675 (+)
Aliases Olr118-ps, Olr118-ps

Sequence information


Nucleotide sequence

ATGACAACACCTTCAACCATTTTAAATTACACCAACGTCAGAGACATCTGGTACACCATG
ATTGGGATCCCAGGACTGGAAGAGTCACACATATGGATCTCCATTCCCATCTGTTCAATG
TACATAGTGGCCATTGCAGGAAATGCCCTGCTATTATTCCTGATCATCACTGAACGCAGC
CTTCATGAACCCATGTACCTTTTCCTGTCCATGTTGGCACTGGCTGATATCTTTCTGTCT
ACAGTCACAACACCAAAAATGTTAGCAATCTTCTGGTTCCAAGCTGCAGGCATTTCCTTC
GCTAGTTGTGTGTCTCAGATGTTTTTCCTCCACTTCATCTTTGTGGCAGAGTCTGCCATA
CTGCTGGCTATGGCATTTGACCGTTATGTGGCCATCTGCTATCCACTAAGATACACCACC
ATTCTAACCCCATCTGTCATCATCAAAATGGGCATTGCATCTGTGATTAGAAGCTTCTTC
ATCTGCTTCCCCCTGATCTTCCTTGTTTATAGGCTCACCTATTGCGGGAAGAACATCATT
CGTCACTTATACTGTGAACACATGGGCATTGCCAGGTTGGCCTGTGACAGCATCAAGGTC
AATATTTACTATGGCATGATAGTGGCTATTTTTTTCTTTATGCCT


Conceptual translation

MTTPSTILNYTNVRDIWYTMIGIPGLEESHIWISIPICSMYIVAIAGNALLLFLIITERS
LHEPMYLFLSMLALADIFLSTVTTPKMLAIFWFQAAGISFASCVSQMFFLHFIFVAESAI
LLAMAFDRYVAICYPLRYTTILTPSVIIKMGIASVIRSFFICFPLIFLVYRLTYCGKNII
RHLYCEHMGIARLACDSIKVNIYYGMIVAIFFFMP\VVLIIVSYALIPRSVFRIPSRDA
RLKALGTCGSHVCVILLFYTPAFFSFFAHRFGGHSIPLHVHILLANLYVVVPPSVNPIIY
GVKTKQIQERVIKIFSLGKSFC