Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52z15 Olfactory Receptor

Gene Symbol Or52z15
Organism Mouse
Family 52
Subfamily z
Pseudo No
Location chr7:103682720-103683682 (+)
Aliases Olfr625

Sequence information


Nucleotide sequence

ATGACAACATCTTCAAACACTTTAAATTATACCAATGTCAGAGATATCTGGTACACCATG
ATTGGGATCCCAGGATTGGAAGAATCACACATATGGATTTCCATCCCCATCTGTTCAATG
TACATAGTGGCCATTGCAGGCAATGCACTGCTATTATTCCTGATCATCACTGAATGCAGC
CTTCATGAACCCATGTACCTATTCCTGTCTATGTTGGCACTTGCTGATATCTTTCTGTCT
ACAGTCACAACACCAAAAATGTTAGCAATCTTCTGGTTCCAAGCTGCAGGCATCTCTTTT
GCTAGCTGTGTATCTCAAATGTTTTTCCTCCACTTCATATTTGTGGCAGAATCTGCAATA
CTGCTGGCTATGGCATTTGACCGTTATGTGGCCATCTGTTATCCACTAAGATACACCACC
ATTCTAACCACATCTGTCATCATCAAAATGGGCATTGCAGCTGTGATTAGAAGCTTCTTC
ATCTGCTTCCCCCTGATCTTTCTTGTCTATAGGCTCACCTATTGTGGGAAGAGCATCATT
CTTCACTCATACTGTGAACACATGGGCATTGCCAGGTTGGCCTGTGACAGCATCAAGGTC
AATATTTACTATGGCATGATAGTGGCTCTATTTTCCATATGCCTAGATGCAGTGCTGATC
ATAGTCTCATATGCCCTTATCCTTTGTGCTGTGTTTAGAATTCCTTCTCGAGATGCCCGA
CTCAAGGCTCTAGGTACTTGTGGTTCCCATGTCTGTGTTATTCTTCTGTTCTATACACCA
GCATTCTTTTCTTTCTTTGCTCATCGTTTTGGGGGTCACAGTATACCACTGCATGTGCAC
ATTCTTCTTGCCAATCTGTATGTGGTAGTACCACCCTCTGTCAACCCCATTATTTATGGA
GTGAGGACTAAACAAATTCAGGAGAGGATTATTCAAATGTTTTCTTTGGGCAAGTCATTT
TGT


Conceptual translation

MTTSSNTLNYTNVRDIWYTMIGIPGLEESHIWISIPICSMYIVAIAGNALLLFLIITECS
LHEPMYLFLSMLALADIFLSTVTTPKMLAIFWFQAAGISFASCVSQMFFLHFIFVAESAI
LLAMAFDRYVAICYPLRYTTILTTSVIIKMGIAAVIRSFFICFPLIFLVYRLTYCGKSII
LHSYCEHMGIARLACDSIKVNIYYGMIVALFSICLDAVLIIVSYALILCAVFRIPSRDAR
LKALGTCGSHVCVILLFYTPAFFSFFAHRFGGHSIPLHVHILLANLYVVVPPSVNPIIYG
VRTKQIQERIIQMFSLGKSFC