Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or55b10 Olfactory Receptor

Gene Symbol Or55b10
Organism Mouse
Family 55
Subfamily b
Pseudo No
Location chr7:102,494,000-102,495,000 (-)
Aliases Olfr545

Sequence information


Nucleotide sequence

MLGWSNGTYNESYTSFLLMGFPGMQEARALLVLPFLSLYLVILFTNALVIHTVASQRSLH
QPMYLLIALLLAVNICAATTVLPPMLFSFSTRFNRISLPRCLGQMFCIYFLVSMDCNILL
VMALDRYVAICYPLRYPEIVTGQLLAGLVVLAVTRSTSIVAPVVVLASRVRFCRSDVIRH
FACEHMALMKLSCGDISLNKTAGLIIRTFNRVLDMLLLGTSYSRIIHAAFRISSGGARSK
ALNTCGSHLLVIFTVYSSTMSSSIVYRVARTASQDVHNLLSAFYLLLPCLVNPIIYGART
KEIRQHLVRSFLSAGP


Conceptual translation

MLGWSNGTYNESYTSFLLMGFPGMQEARALLVLPFLSLYLVILFTNALVIHTVASQRSLH
QPMYLLIALLLAVNICAATTVLPPMLFSFSTRFNRISLPRCLGQMFCIYFLVSMDCNILL
VMALDRYVAICYPLRYPEIVTGQLLAGLVVLAVTRSTSIVAPVVVLASRVRFCRSDVIRH
FACEHMALMKLSCGDISLNKTAGLIIRTFNRVLDMLLLGTSYSRIIHAAFRISSGGARSK
ALNTCGSHLLVIFTVYSSTMSSSIVYRVARTASQDVHNLLSAFYLLLPCLVNPIIYGART
KEIRQHLVRSFLSAGP