Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or55b10 Olfactory Receptor

Gene Symbol Or55b10
Organism Mouse
Family 55
Subfamily b
Pseudo No
Location chr7:102493826-102494773 (-)
Aliases Olfr545, MGC129241, MOR42-1

Sequence information


Nucleotide sequence

ATGTTGGGTTGGAGCAATGGCACCTACAATGAGTCCTACACCAGCTTCCTCCTCATGGGC
TTCCCAGGGATGCAGGAAGCCAGAGCCCTCCTGGTGCTGCCCTTCCTCAGCCTCTACCTG
GTGATCCTCTTCACCAATGCCCTGGTCATCCACACGGTGGCATCCCAGCGCAGCCTGCAC
CAGCCCATGTACCTGCTCATTGCCCTGCTCCTGGCTGTCAATATCTGTGCTGCCACCACG
GTGCTGCCCCCCATGCTCTTCAGCTTCTCCACACGCTTCAACCGCATCTCCCTCCCTCGA
TGCTTGGGACAGATGTTCTGCATCTACTTTCTGGTTTCTATGGACTGCAACATCCTCCTG
GTCATGGCTCTAGATCGCTATGTGGCTATCTGCTACCCTCTCCGCTACCCAGAAATAGTG
ACAGGACAGTTACTGGCTGGTCTGGTGGTGTTGGCAGTCACCAGGAGCACAAGCATTGTT
GCTCCAGTGGTGGTGCTGGCCTCGCGGGTTCGCTTCTGCCGCTCAGATGTGATCCGCCAC
TTTGCCTGTGAGCACATGGCCCTGATGAAGCTTTCCTGTGGAGACATCTCGCTGAATAAA
ACGGCGGGACTCATTATTCGAACCTTTAATAGAGTCCTGGATATGCTCCTTCTAGGCACC
TCCTACTCCCGCATCATCCATGCTGCCTTCAGGATCTCATCAGGTGGAGCACGGTCCAAA
GCCCTGAACACCTGTGGTTCCCACCTGCTGGTCATCTTCACCGTCTACTCCTCCACCATG
TCCTCATCCATTGTCTACCGTGTGGCTCGCACTGCCTCCCAAGATGTGCACAACCTGCTC
AGTGCTTTCTATCTGTTGCTCCCGTGTCTGGTCAACCCCATCATCTACGGGGCCAGAACC
AAGGAAATCAGGCAGCACCTGGTAAGGTCATTCCTGAGTGCAGGCCCC


Conceptual translation

MLGWSNGTYNESYTSFLLMGFPGMQEARALLVLPFLSLYLVILFTNALVIHTVASQRSLH
QPMYLLIALLLAVNICAATTVLPPMLFSFSTRFNRISLPRCLGQMFCIYFLVSMDCNILL
VMALDRYVAICYPLRYPEIVTGQLLAGLVVLAVTRSTSIVAPVVVLASRVRFCRSDVIRH
FACEHMALMKLSCGDISLNKTAGLIIRTFNRVLDMLLLGTSYSRIIHAAFRISSGGARSK
ALNTCGSHLLVIFTVYSSTMSSSIVYRVARTASQDVHNLLSAFYLLLPCLVNPIIYGART
KEIRQHLVRSFLSAGP