Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or55b10 Olfactory Receptor

Gene Symbol Or55b10
Organism Rat
Family 55
Subfamily b
Pseudo No
Location chr1:167,605,000-167,606,000 (-)
Aliases Olr40

Sequence information


Nucleotide sequence

ATGCCCTCAGGCATCATGTCAGGGTGGAGCAATGGCACCTACAATGAATCCTACACCAGC
TTCCTCCTCATAGGCTTCCCAGGGATTCAGGAAGCCAGAGCCCTCCTGATGCTGCCCTTC
CTCAGCCTCTACCTGGTGATCCTCTTCACCAACGCCCTGGTCATCCACACGGTGGCATCC
CAGCGCAGCCTGCACCAGCCCATGTACCTGCTCATCGCCCTGCTCCTGGCTATCAATATC
TGTGCTGCCACCACGGTGCTGCCCGCCATGCTCTTCAGCTTCTCCACAAGTTTCAACCGC
ATCTCTCTCCCTCGATGCTTGGGACAGATGTTCTGCATCTACTTCCTGGTTTCTATGGAT
TGCAACATCCTCCTTGTCATGGCCTTGGACCGCTATGTGGCTATCTGCTATCCTCTCCGC
TACCCAGAGATAGTGACAGGACAGTTACTGGCTGGTCTGGTGGTGGTGGCAGTCACCAGG
AGTACATGCATCGTAGCTCCAGTGGTGGTGCTGGCCTCGCGGGTCCGCTTCTGCCGCTCA
GATGTGATCCACCACTTTGCCTGTGAACACATGGCCCTCATGAAGCTCTCCTGTGGAGAT
ACCTCACTGAATAAGACTGTGGGACTCATTATTCGAACCTTTAACAGAGTCCTGGATATG
CTCCTGCTGGGCGCCTCCTACTCCCGCATCATCCATGCTGCCTTCAGGATCTCATCAGGA
GGAGCGCGGTCCAAAGCTCTCAACACCTGTGGCTCCCACCTTCTGGTCATCTTCACCGTC
TACTCCTCCACCATGTCCTCATCCATTGTCTACCGTGTGGCCCGCACTGCCTCCCAAGAT
GTGCACAACCTGCTCAGTGCTTTCTACCTGTTGCTTCCGTGTCTGGTCAACCCCATCATC
TATGGGGCCAGAACCAAGGAAATCAGGCAGCACCTGGTAAGGTCATTCCTGAGTGCAGGC
CCG


Conceptual translation

MPSGIMSGWSNGTYNESYTSFLLIGFPGIQEARALLMLPFLSLYLVILFTNALVIHTVAS
QRSLHQPMYLLIALLLAINICAATTVLPAMLFSFSTSFNRISLPRCLGQMFCIYFLVSMD
CNILLVMALDRYVAICYPLRYPEIVTGQLLAGLVVVAVTRSTCIVAPVVVLASRVRFCRS
DVIHHFACEHMALMKLSCGDTSLNKTVGLIIRTFNRVLDMLLLGASYSRIIHAAFRISSG
GARSKALNTCGSHLLVIFTVYSSTMSSSIVYRVARTASQDVHNLLSAFYLLLPCLVNPII
YGARTKEIRQHLVRSFLSAGP