Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or55b3 Olfactory Receptor

Gene Symbol Or55b3
Organism Mouse
Family 55
Subfamily b
Pseudo No
Location chr7:102,477,000-102,478,000 (-)
Aliases Olfr543

Sequence information


Nucleotide sequence

MGEDGNTSIFNLSYSSFLLVGFPGLQEGRPLLVLPLTFLYVSIVSANALVIHTVVAQRSL
HQPMYVLIALLLAVNICASTAVRPKMLEGFVHYANPISLRGCLTQMFFIYFTLLLDYNLL
LAMALDRYVAICHPLRYTDLMTSHLLGLMATFAITRSLGVAVPLVVLTAKAQFCKTSVIR
HFTCEYIALLSIACGDLTFNNRLGLAMRLVTVTFDLALLGTSYTRIIYAAFRISSGGARA
KALHTCGSHLLVILTIYLSGLSTSIVFRVAKTVSQDVQNLLSAIYLLLPGALNPLIYGVR
TKEIRQHIEKMLCGMQSPQDSREKSQNVRGERDLPG


Conceptual translation

MGEDGNTSIFNLSYSSFLLVGFPGLQEGRPLLVLPLTFLYVSIVSANALVIHTVVAQRSL
HQPMYVLIALLLAVNICASTAVRPKMLEGFVHYANPISLRGCLTQMFFIYFTLLLDYNLL
LAMALDRYVAICHPLRYTDLMTSHLLGLMATFAITRSLGVAVPLVVLTAKAQFCKTSVIR
HFTCEYIALLSIACGDLTFNNRLGLAMRLVTVTFDLALLGTSYTRIIYAAFRISSGGARA
KALHTCGSHLLVILTIYLSGLSTSIVFRVAKTVSQDVQNLLSAIYLLLPGALNPLIYGVR
TKEIRQHIEKMLCGMQSPQDSREKSQNVRGERDLPG