Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or55b4 Olfactory Receptor

Gene Symbol Or55b4
Organism Rat
Family 55
Subfamily b
Pseudo No
Location chr1:167,588,000-167,589,000 (-)
Aliases Olr39

Sequence information


Nucleotide sequence

ATGTCAGGGTGGAGCAATGGCACCTACAATGAGTCCTACACCAGCTTCCTCCTCATAGGC
TTCCCAGGGATTCAGGAAGCCAGAGCCCTCCTGGTGCTGCCCTTCCTCAGCCTCTACCTG
GTGATCCTCTTCACCAACGCCCTGGTCATCCACACGGTGGCATCCCAGCGCAGCCTGCAC
CAGCCCATGTACCTGCTCATCGCCCTGCTCCTGGCTATCAATATCTGTGCTGCCACCACG
GTGCTGCCCGCCATGCTCTTCAGCTTCTCCACGAGCTTCAACCGCATCTCTCTCCCTCGA
TGCTTGGGACAGATGTTCTGCATCTACTTCCTTATTGTCTTTGACTGCAACATCCTCCTT
GTCATGGCCTTGGACCGCTATGTGGCTATCTGCTATCCTCTCCGCTACCCAGAGATAGTG
ACAGGACAGTTACTGGCTGGTCTGGTGGTGGTGGCAGTCACCAGGAGTACATGCATCGTT
GCTCCAGTGGTGGTGCTGGCCTCGCGGGTCCGCTTCTGCCGCTCAGATGTGATCCACCAC
TTTGCCTGTGAACACATGGCCCTCATGAAGCTCTCCTGTGGGGATATCTCACTGAATAAG
ACTGTGGGACTCACAGTTCGCATCTTCAACAGAGTCCTGGATATGCTCCTGCTGGGCGCC
TCCTACTCCCGCATCATCCATGCTGCCTTCAGGATCTCATCAGGAGGAGCGCGGTCCAAA
GCCCTCAACACCTGTGGCTCCCACCTTCTGGTCATCTTCACCGTCTACTCCTCCACCATG
TCCTCATCCATTGTCTACCGTGTGGCCCGCACTGCCTCCCAAGATGTGCACAACCTACTC
AGTGCTTTCTACCTGTTGCTTCCGTGTCTGGTCAACCCCATCATCTATGGGGCCAGAACC
AAGGAAATCAGGCAACACCTAGTAACTCTCTTCCAAAGGACTCAGCAACAGGTCTCCACT
GAGAAGCCCCAGTCCCTGCCCCTCGAA


Conceptual translation

MSGWSNGTYNESYTSFLLIGFPGIQEARALLVLPFLSLYLVILFTNALVIHTVASQRSLH
QPMYLLIALLLAINICAATTVLPAMLFSFSTSFNRISLPRCLGQMFCIYFLIVFDCNILL
VMALDRYVAICYPLRYPEIVTGQLLAGLVVVAVTRSTCIVAPVVVLASRVRFCRSDVIHH
FACEHMALMKLSCGDISLNKTVGLTVRIFNRVLDMLLLGASYSRIIHAAFRISSGGARSK
ALNTCGSHLLVIFTVYSSTMSSSIVYRVARTASQDVHNLLSAFYLLLPCLVNPIIYGART
KEIRQHLVTLFQRTQQQVSTEKPQSLPLE