Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or56a3 Olfactory Receptor

Gene Symbol Or56a3
Organism Mouse
Family 56
Subfamily a
Pseudo No
Location chr7:105,086,000-105,087,000 (+)
Aliases Olfr679

Sequence information


Nucleotide sequence

MTAHKNDTNPTGVSDFLLNCFVRSPSWQLWLSLPLSLLFLLAMGANAILLITIRMEASLH
EPMYYLLSLLSMLDIILCLTVIPKVLAIFWFDLRAIGFPACFLQMYIMNSFLAMESCTFM
IMAFDRYIAICHPLRYPSIITDQFVVKAATFILVRNVLITLPIPILSARLHYCGRNVIEN
CICANMSVSRLSCNDVNVNRLYQFAIGWTLLGSDLFLIFLSYTLILRAVLRLKAEGAVAK
ALSTCGSHFILILFFSTILLVFILTHVAKRKVSSDVPILLNVLHHVIPAALNPIVYGVRT
QEIKQGIKKLLKKGW


Conceptual translation

MTAHKNDTNPTGVSDFLLNCFVRSPSWQLWLSLPLSLLFLLAMGANAILLITIRMEASLH
EPMYYLLSLLSMLDIILCLTVIPKVLAIFWFDLRAIGFPACFLQMYIMNSFLAMESCTFM
IMAFDRYIAICHPLRYPSIITDQFVVKAATFILVRNVLITLPIPILSARLHYCGRNVIEN
CICANMSVSRLSCNDVNVNRLYQFAIGWTLLGSDLFLIFLSYTLILRAVLRLKAEGAVAK
ALSTCGSHFILILFFSTILLVFILTHVAKRKVSSDVPILLNVLHHVIPAALNPIVYGVRT
QEIKQGIKKLLKKGW