Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or56a41-ps Olfactory Receptor

Gene Symbol Or56a41-ps
Organism Rat
Family 56
Subfamily a
Pseudo Yes
Location chr1:169,971,000-169,972,000 (-)
Aliases Olr191-ps

Sequence information


Nucleotide sequence

ATGAAACCTATCAGCTTTGTGGGCTGCTTCCTGCAGATGTTCATCATGAATACCTTCCTT
CCTATGGAATCTTCTACCTTTCTGGTCATGGCCTATGATCGCTATGTGGCTATCTGCCAT
CCCCTACGCTACCCATCCATCATCACAGAACAGTTTGTCATCAATGCAGCCATTTTTATT
GTTGCCCGCAATTTTCTAGCTACACTGCCCACTCCAGTTCTGGCTGCTAGACTCAATTAC
TGTGCAAGCAATGTGGTGGAGAACTGCATATGTGCCAATATTTCCGTAGCAAAGCTTTCC
TGTGGGGACATTCGTCTAAATAAGCTCTATCAGTTTGTGAGCGTTTGGTGCCTACTAGGT
TCTGATCTGGTGCTCATCTTGCTGTCTTACTGTTTCATCTTGAGGGTTGTTATGTGTCAG
CAGTCGGGAGGTGCAGTCACCAAGGCCTTGAGTACTTGCGGTTCACATCTCATCCTTATA
CTTTTCTTCTATACACTGTTGCTAGTCTTTATTTTCACAAACAAGGCAGGAAAGAAGATA
CCATCAGAGGTACCGATTCTTCTCAATGTGCTGCATCATCTCATCCCACCTGCCCTCAAT
CCTATTGTATATGGAGTACGAACCCAGGAAATCAAGCAGGGGATTATCAAACTATTCAAA
CAC


Conceptual translation

MKPISFVGCFLQMFIMNTFLPMESSTFLVMAYDRYVAICHPLRYPSIITEQFVINAAIFI
VARNFLATLPTPVLAARLNYCASNVVENCICANISVAKLSCGDIRLNKLYQFVSVWCLLG
SDLVLILLSYCFILRVVMCQQSGGAVTKALSTCGSHLILILFFYTLLLVFIFTNKAGKKI
PSEVPILLNVLHHLIPPALNPIVYGVRTQEIKQGIIKLFKH