Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or56a42-ps Olfactory Receptor

Gene Symbol Or56a42-ps
Organism Mouse
Family 56
Subfamily a
Pseudo Yes
Location chr7:105126369-105127029 (-)
Aliases Olfr682-ps1, MOR40-19_p

Sequence information


Nucleotide sequence

ATGAAACCCATCAGCTTTGTGGGCTGCTTCCTGCAGATGTTTGTCATGAATACCTTCCTT
CCTATGGAATCCTCTACCTTTCTGGTCATGGCCTATGATCGCTATGTGGCTATCTGCCAT
CCTCTGCGCTACCCATCCATCATCACAGAACAGTTTGTCATTAATGCAGCCATTTTTATT
GTTGCCCGCAATCTTCTAGCTACACTGCCCACTCCAGTTCTGGCTGCTAGACTCAATTAC
TGTGCCAGCAATGTGGTGGAGAACTGCATATGTGCCAATATTTCTGTAGCAAAGCTTTCC
TGTGGGGACATTCGCCTAAATAAGCTCTATCAATTTGTGAGCGTTTGGTGCCTACTTGGT
TCTGATCTGGTCCTCATTTTGCTCTCTTACTGCTTCATCTTGAGGGTTGTTATGTGTCAG
CAGTCTGGAGGCACTGTCACCAAGGCCTTGAGTACTTGTGGTTCACATCTCATCCTTATA
CTCTTCTTATACTTTGTTGCTAGTCTTTATCTTCACAAACAAGGCAGGAAAGAAGATACC
GTCAGAGGTACCAATTCTTCTTAATGTGCTGCATCATCTCATCCCACCTGCCCTCAATCC
CATTGTGTATGGAGTACGAACCCAGGAAATCAAGCAGGGGATTATCAAGCTATTCAAACA
C


Conceptual translation

MKPISFVGCFLQMFVMNTFLPMESSTFLVMAYDRYVAICHPLRYPSIITEQFVINAAIFI
VARNLLATLPTPVLAARLNYCASNVVENCICANISVAKLSCGDIRLNKLYQFVSVWCLLG
SDLVLILLSYCFILRVVMCQQSGGTVTKALSTCGSHLILILFLYFVASLYL\NKAGKKI
PSEVPILLNVLHHLIPPALNPIVYGVRTQEIKQGIIKLFKH