Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or56a5 Olfactory Receptor

Gene Symbol Or56a5
Organism Rat
Family 56
Subfamily a
Pseudo No
Location chr1:169,991,000-169,992,000 (-)
Aliases Olr192

Sequence information


Nucleotide sequence

ATGATCAGAAGGCAACACATGGAAGCACAAAGCAATATTTCCTCTATCCTGGTCCCTGAC
TTCCTTCTCATCTGCTTCCCCAACTATCAGACCTGGCAGCATTGGCTGTCCCTGCCCCTC
AGCCTCCTCTTCCTCCTGGCCATGGGGGCCAATGCCACCCTTCTCATCACCATCAGGATG
GAGGCCTCTCTGCATGAGCCCATGTACTACCTGCTCAGCCTTCTGTCCCTGCTAGACATT
GTGCTCTGCCTCACAGTCATACCAAAGGTCCTGGCCATCTTCTGGTTTGACAATAAATCC
ATCGGCTTCTCTGCCTGCTTCCTCCAGATGTTTGTCATGAACAGTTTCCTGACGATGGAG
TCTTGCACCTTCATGGTCATGGCCTATGACCGCTATGTGGCCATCTGTAAGCCTCTGCAG
TATCCGTCCATCATCACTGACCAGTTTGTGGTTAGGGCTGCCATCTTTGTAGCAACCAGA
AATGGTATTCTTACTATGCCCATCCCCATATTTTCTTCCCAACTGAGATATTGTGCAAGA
ATTATCAAGAACTGCATCTGCACTAACATGTCTGTATCCAGACTCTCCTGTGATGACATC
ACTTTTAATAAACTGTACCAGTTTGTCATAGGTTGGACCCTGCTGGGCTCTGACCTCATC
CTCATTGTCCTATCTTATTCTTTCATTCTGAAGGCTGTGCTCAGGATCAAAGCAGAGGGA
GCTGTGGCCAAGGCCCTGAGCACATGTGGTTCCCACTTCATCCTCATTCTCTTCTTCAGC
ACAGTCCTGTTGGTGCTGGTCATCACTAACCTGGCCAGGGAGAGGATTCCTCCGGATGTC
CCCATCCTGCTCAATATACTTCATCACCTCATCCCCCCAGCTCTGAATCCCATTGTTTAT
GGGGTGAGAACCAGGGAGATTAAGCAGGGAATAAGGAACCTGCTTAGGAGGTTC


Conceptual translation

MIRRQHMEAQSNISSILVPDFLLICFPNYQTWQHWLSLPLSLLFLLAMGANATLLITIRM
EASLHEPMYYLLSLLSLLDIVLCLTVIPKVLAIFWFDNKSIGFSACFLQMFVMNSFLTME
SCTFMVMAYDRYVAICKPLQYPSIITDQFVVRAAIFVATRNGILTMPIPIFSSQLRYCAR
IIKNCICTNMSVSRLSCDDITFNKLYQFVIGWTLLGSDLILIVLSYSFILKAVLRIKAEG
AVAKALSTCGSHFILILFFSTVLLVLVITNLARERIPPDVPILLNILHHLIPPALNPIVY
GVRTREIKQGIRNLLRRF