Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or56b2 Olfactory Receptor

Gene Symbol Or56b2
Organism Mouse
Family 56
Subfamily b
Pseudo No
Location chr7:104,688,000-104,689,000 (+)
Aliases Olfr661

Sequence information


Nucleotide sequence

MFQILRDSNSSRFQVSEFILMGFPGIHSWQHWLSLPLALLYVLALIANILIVTVIYQEAS
LHQPMYHFLGILAIVDVGLATTIMPKILAILWFNDNNISLPECFAQMYAIHCFVAMESGI
FVCMAIDRYVAICKPLRYSSIVTESFVVKATVIMAIRNFVAPMSVPVLAAQRNYCFQNKI
EHCLCSNLGVTSLACDDRKINSINQLFLAWTLMGSDLALIMISYALILRSVLRLNSAEAA
SKALSTCTSHLILIFFFYTVIVVISITHSVGIKIPLIPVLLNVLHNVIPPALNPMVYALK
NKELKQGLYKVLRLDVKEG


Conceptual translation

MFQILRDSNSSRFQVSEFILMGFPGIHSWQHWLSLPLALLYVLALIANILIVTVIYQEAS
LHQPMYHFLGILAIVDVGLATTIMPKILAILWFNDNNISLPECFAQMYAIHCFVAMESGI
FVCMAIDRYVAICKPLRYSSIVTESFVVKATVIMAIRNFVAPMSVPVLAAQRNYCFQNKI
EHCLCSNLGVTSLACDDRKINSINQLFLAWTLMGSDLALIMISYALILRSVLRLNSAEAA
SKALSTCTSHLILIFFFYTVIVVISITHSVGIKIPLIPVLLNVLHNVIPPALNPMVYALK
NKELKQGLYKVLRLDVKEG