Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or56b2 Olfactory Receptor

Gene Symbol Or56b2
Organism Rat
Family 56
Subfamily b
Pseudo No
Location chr1:169,670,000-169,670,000 (+)
Aliases Olr161

Sequence information


Nucleotide sequence

ATGTTCCAGATCCTCAGGGATTCTAACAGCTCTAGGTTCCAGGTGTCTGAGTTCATTCTG
ATGGGATTTCCAGGTATCCACAGCTGGCAGCACTGGCTCTCCCTGCCCCTGGCTCTGCTC
TATGTCCTGGCTCTCATTGCCAACATACTTATTGTGAGCATCATTTACCAAGAGGCATCA
CTACACCAGCCTATGTACTATTTCCTGGGCATCCTTGCTATTGTGGACATGGGTCTGGCA
ACTACTATCATGCCCAAGATTTTAGCCATCTTATGGTTCAATGATAACAACATCAGCCTC
CCTGAGTGCTTTGCTCAGATGTATACCATCCATTGCTTTGTTGCCATGGAGTCAGGTATC
TTTGTCTGCATGGCTATAGATAGGTATGTGGCAATTTGCAGACCACTGAGATACTCTTCA
ATAGTTACTGAATCTTTTGTGATCAAAGCAACTGTGTTTATGACCTTCAGAAATTTTGTG
GCTCCCATTTCAGTACCTGTGTTGGCTGCTCAGAGAAATTACTGTTCTCAGAATAAAATT
GAGCACTGCCTATGCTCTAACCTTGGGGTCACTAGCCTTGCCTGTGATGACAGGAAAATT
AACAGCATCAACCAGTTATTCCTGGCTTGGACACTCATGGGAAGTGACCTTGGTTTAATT
ATTGTTTCCTATGCTTTGATTCTTCGGTCTGTGCTGAGGTTGAACTCTGCAGAAGCTGCA
TCTAAAGCTTTAAGTACCTGTACTTCTCACCTCATCCTAATCTTTTTCTTCTACACAGTC
ATTGTTGTTATGTCCATCACTCACAGTGTAGGAATGAAAATTCCACTCATCCCAGTTCTG
CTGAATGTGCTCCACAATGTTATTCCCCCTGCTCTGAACCCCATGGTGTATGCCCTTAAG
AACAAAGAGCTCAAACAAGGCTTGTACAAGGTGCTTAGGCTGGATGTCAAAGGAGGC


Conceptual translation

MFQILRDSNSSRFQVSEFILMGFPGIHSWQHWLSLPLALLYVLALIANILIVSIIYQEAS
LHQPMYYFLGILAIVDMGLATTIMPKILAILWFNDNNISLPECFAQMYTIHCFVAMESGI
FVCMAIDRYVAICRPLRYSSIVTESFVIKATVFMTFRNFVAPISVPVLAAQRNYCSQNKI
EHCLCSNLGVTSLACDDRKINSINQLFLAWTLMGSDLGLIIVSYALILRSVLRLNSAEAA
SKALSTCTSHLILIFFFYTVIVVMSITHSVGMKIPLIPVLLNVLHNVIPPALNPMVYALK
NKELKQGLYKVLRLDVKGG