Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or56b35 Olfactory Receptor

Gene Symbol Or56b35
Organism Mouse
Family 56
Subfamily b
Pseudo No
Location chr7:105,314,000-105,315,000 (+)
Aliases Olfr689

Sequence information


Nucleotide sequence

MGTKHATNSSEFQVSEFILLGFPGIHEFQIWLSLPMALLYIIALGANFLILITIYLEPNL
HQSMYQFLGILAVVDIGLATTSMPKILAILWFDAKTISLPECFAQIYAIHTFMSMESGVF
LCMAIDRYVAICYPLQYPSIVTEAFVIKATLSMMLRSGLLTIPVPVLAAQRQYCSRNEID
HCLCSNLGVISLACDDITVNRNCQLTLAWLILGIDMILVCVSYALIIRSVLRLNSTEAVS
KALSTCSSHLILIMFYYTAIVILSVTHLAGRRVPLIPVLLNVMHIVIPPSLNPMVYALRT
QELKVGFRKVFDLSHYVSRK


Conceptual translation

MGTKHATNSSEFQVSEFILLGFPGIHEFQIWLSLPMALLYIIALGANFLILITIYLEPNL
HQSMYQFLGILAVVDIGLATTSMPKILAILWFDAKTISLPECFAQIYAIHTFMSMESGVF
LCMAIDRYVAICYPLQYPSIVTEAFVIKATLSMMLRSGLLTIPVPVLAAQRQYCSRNEID
HCLCSNLGVISLACDDITVNRNCQLTLAWLILGIDMILVCVSYALIIRSVLRLNSTEAVS
KALSTCSSHLILIMFYYTAIVILSVTHLAGRRVPLIPVLLNVMHIVIPPSLNPMVYALRT
QELKVGFRKVFDLSHYVSRK