Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or56b37-ps Olfactory Receptor

Gene Symbol Or56b37-ps
Organism Rat
Family 56
Subfamily b
Pseudo Yes
Location chr1:169795034-169795991 (-)
Aliases Olr166-ps

Sequence information


Nucleotide sequence

GCAAAATCATCCTAAATATAATGATCTGAGGTAAGCTCCTTCCTGACAATCATATTGCTG
ATCTAAACTAACAAGATTAACCATTTTCCTCTAGCAAAAGATGTTCCAGGATGTGACAAA
TTCCAAAAGCTCTAGATTTCAAGTGTCTGAGTTCATTCTGATGGGATTTCCAGGTATCCA
CAGATGGCAGCAGTGACTTTCTTTGCCACTGGCTCTATTCTGTCTTGGCTCTTACAGCCA
ACATACTTATTACCATAATCTGCCAGGTAGTGTCACTACACCAGCCCTGAACCATTTCAT
GGACATCCAGACTATAGTAAACATGGGCTTGGCAATCACCATCGTGCCCAAGATTTTAGT
CATCTTGTGGTTGAATGATAACACCATCAGCCTTCCAGAGTGCTCTGTTCAGCTATATGT
TTGTTTTTTTTTTATGAAGTCAGACATCTTTTTTCTTGGCCATTTATAGATATGTGGCTA
TTTGTAGAACATTGAGATACTCTTCAATAGTTACTGAATCTTTTGTGATCATACCAACTG
TGTTTATGGTCCTCAGAAACTTTAAGTGTTCTGTGTTAGGACCTGTATTGGCTGCTCAGA
GAAATTGCTATTTCCAAAATCAAATCTACCACTGCTTTCTACTGACCTGGGGGTCATTAG
TTTTACCTGTGATGACAGGAAAATTAACAGCATCAGCCAGTTATTTCTGGGTTGGGCAGT
CATGGGAAGTGACCTTGGTTCAATTATGTTCATTTATGATCATTTATGTTCATTTATGTT
TTGATTCTTCTGTCTGTGCTGAGGCTGAACTCTGCAGAAGCTGCATCTACAGCCTTAAGT
ACCTGTATTTCTCAGTGAAGGACTCTAGGGGCTTTTGCCAGCCTTACACCCACTGCCTCA
GGTCAAGGCTAGGCCAAGTTCCATTCTCATCCCAGAGTTCTCTGGAGGAGCAGGAACA


Conceptual translation

SKSSRFQVSEFILMGFPGIHRWQQ*LSLPLALF\LALTANILITIICQVVSLHQP*/H
FMDIQTIVNMGLAITIVPKILVILWLNDNTISLPECSVQLYVCFFFMKSD\FFLAIYRY
VAICRTLRYSSIVTESFVIIPTVFMVLRNFKCSVLGPVLAAQRNCYFQNQIYHCFLL/L
GVISFTCDDRKINSIS/VISGLGSHG/VTLVQLCSFMIIYVHLCFDSS\VLRLNSAE
AASTALSTCISQ