Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or56b6 Olfactory Receptor

Gene Symbol Or56b6
Organism Mouse
Family 56
Subfamily b
Pseudo No
Location chr7:105,276,000-105,276,000 (+)
Aliases Olfr687

Sequence information


Nucleotide sequence

MALLYIVALGANLLILITIYLEPTLHQPMYQFLGILAAVDIGLATTSMPKILAILWFDAK
TISLPECFAQIYAIHTFMCMESGVFLCMAIDRYVAICYPLQYPSIVTEAFVIKATLSMLL
RNGLLTIPVPVLAAQRQYCSRNEIDHCLCSNLGVISLACDDITVNRFYQLALAWLVVGSD
MILVYASYALIIRSVLRLNSTEAASKALSTCSSHLILIMFYYTAIVIVSVTHLAGRRVPL
IPVLLNVMHIVIPPSLNPMVYALRTQELKVGFRKVFESLCVQKVN


Conceptual translation

MALLYIVALGANLLILITIYLEPTLHQPMYQFLGILAAVDIGLATTSMPKILAILWFDAK
TISLPECFAQIYAIHTFMCMESGVFLCMAIDRYVAICYPLQYPSIVTEAFVIKATLSMLL
RNGLLTIPVPVLAAQRQYCSRNEIDHCLCSNLGVISLACDDITVNRFYQLALAWLVVGSD
MILVYASYALIIRSVLRLNSTEAASKALSTCSSHLILIMFYYTAIVIVSVTHLAGRRVPL
IPVLLNVMHIVIPPSLNPMVYALRTQELKVGFRKVFESLCVQKVN