Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or56b6 Olfactory Receptor

Gene Symbol Or56b6
Organism Rat
Family 56
Subfamily b
Pseudo No
Location chr1:170,109,000-170,110,000 (+)
Aliases Olr198

Sequence information


Nucleotide sequence

ATGGGTACTGCCTTGCATGAAACCAACAACTCAGAGGTCCACGTGACCGAGTTCTTTCTG
CTGGGATTCCCAGGCATTCATGACTTCCAGCACTGGATCTCCTTGCCTATGGCTCTGCTT
TACTTTGTAGCTCTTGGTGCCAATATCCTTATCTTGATCACCATCTACTGTGAGCCGAAC
CTGCATCAGCCAATGTACCAGTTTCTTGGTATCTTGGCTGCAGTAGATATTGGCTTGGCT
ACCACCAGCACCCCCAAGATCCTGGCCATCTTGTGGTTTGATGCCAAGACCATCAGCCTC
CCTGAGTGTTTTGCTCAGATCTATGCAATCCATACTTTTATGGGCATGGAGTCAGGCATC
TTCCTATGCATGGCAATAGATAGATACGTAGCCATTTGTTATCCCCTCAGGTATCCTTCC
ATAGTCACTGAAGCTTTTGTAATCAAAGCTACACTGACCATGCTGCTAAGGAACAGCCTG
TTATCCATGCCAGTCCCTGTACTAGCTGCCCAGAGACAGTACTGCTCCAGAAATGAAATA
GATCACTGCCTTTGCTCTAACTTGGGGGTTATTAGTCTGGCCTGTGATGATATCACTGTT
AACAGGGACTACCAGTTGACTTTGGCCTGGTTTATACTTGGAATTGACATGATTCTGGTC
TGTGTTTCTTATGCTTTGATTATTCGCTCAGTACTGAGGCTGAACTCCACTGAGGCAATA
TCTAAGGCCCTCAGTACCTGCAGCTCCCACCTCATCCTCATTTTGTTTTACTACACAGCT
ATTGTTATATTATCTGTCACTCACCTAGCAGGAAGAAGGGTTCCCCTCATCCCTGTTCTC
CTCAATGTGTTACATATTGTCATCCCTCCATCCCTTAACCCCATGGTATATGCCCTTAGG
ACACAGGAGCTGAAGGTGGGCTTCCAGAAGGTATTTGTCTTGGGTGATTATGTATCCAGA
AAA


Conceptual translation

MGTALHETNNSEVHVTEFFLLGFPGIHDFQHWISLPMALLYFVALGANILILITIYCEPN
LHQPMYQFLGILAAVDIGLATTSTPKILAILWFDAKTISLPECFAQIYAIHTFMGMESGI
FLCMAIDRYVAICYPLRYPSIVTEAFVIKATLTMLLRNSLLSMPVPVLAAQRQYCSRNEI
DHCLCSNLGVISLACDDITVNRDYQLTLAWFILGIDMILVCVSYALIIRSVLRLNSTEAI
SKALSTCSSHLILILFYYTAIVILSVTHLAGRRVPLIPVLLNVLHIVIPPSLNPMVYALR
TQELKVGFQKVFVLGDYVSRK