Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5a1 Olfactory Receptor

Gene Symbol Or5a1
Organism Mouse
Family 5
Subfamily a
Pseudo No
Location chr19:12119724-12120674 (-)
Aliases Olfr76, MOR215-3, V5, MOR215-3, V5

Sequence information


Nucleotide sequence

ATGGCTCTAACCAACACATGGAACAGCTCATCAGTAACCATGTTCATCTTCTTGGGATTC
TCAGACCACCCAGAACTCCGAATCTTCCTCTTTCTGACTTTCTTGAGCATCTATCTTGTG
ACCTTGACCTGGAACCTGGCCCTCATCTTTCTGATCAGAGGTGACATCCATTTACACACA
CCCATGTACTTCTTCCTCAGCAATTTGTCCTTCGTTGACATTTGCTACTCATCCTCTGTA
GCTCCCAAGATGCTCTCTGATTTCTTTCGAGAGCAAAAGACTATCTCATTCCTGGGATGT
GGTGCTCAGTTCTTCTTCTTTGTGGGTTTGGGCCTAACTGAGTGCTTCCTGCTGACAGCA
ATGGCATATGATAGATATGCAGCCATCTCTAACCCCCTGCTCTACACCACCATCATGCCC
CAGGGTCTCTGCATGCGCATGGTGGCTGGGGCATATCTTGGTGGCTTCCTGAGTTCTTTT
ATTCAGGCCAGTTCCATATTTCAGCTCCACTTTTGCGGGCCAAATGTCATCAACCACTTC
TTCTGTGACCTCCCACCAATCCTGGCACTTTCTTGCTCTAACACGTTCCTCAGCCAAGTG
GTGAATTTCCTCATAGTGATCACAGTAGGTGGGACGTCATTTCTCATCCTGCTGATCTCC
TACAGTTACATAGTGTCTGCTGTCTTGAAGATCCACTCTGTGAGAGGCCGGTGGAAAGCC
TTCAACACATGTGCCTCGCACCTCATGGCAGTGACCATGCTGTTTGGGACGGCACTTTTC
ATGTACCTGCGGCCCAGCTCCAGCTACTCATTTAGCAGAGACAAGGTAGTGTCTGTCTTC
TATTCGCTGGTGATTCCCATGCTGAACCCTCTCATTTATAGTTTGAGGAACAAAGAAATC
AAAGATGCCCTGTGGAAAGTGATGGAGAGAAAGAAAGTGTTTCCTAACTTG


Conceptual translation

MALTNTWNSSSVTMFIFLGFSDHPELRIFLFLTFLSIYLVTLTWNLALIFLIRGDIHLHT
PMYFFLSNLSFVDICYSSSVAPKMLSDFFREQKTISFLGCGAQFFFFVGLGLTECFLLTA
MAYDRYAAISNPLLYTTIMPQGLCMRMVAGAYLGGFLSSFIQASSIFQLHFCGPNVINHF
FCDLPPILALSCSNTFLSQVVNFLIVITVGGTSFLILLISYSYIVSAVLKIHSVRGRWKA
FNTCASHLMAVTMLFGTALFMYLRPSSSYSFSRDKVVSVFYSLVIPMLNPLIYSLRNKEI
KDALWKVMERKKVFPNL