Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Rat symbols

Rat Or5a1 Olfactory Receptor

Gene Symbol Or5a1
Organism Rat
Family 5
Subfamily a
Pseudo No
Location chr1:228557643-228558593 (-)
Aliases Olr326, Olr326

Sequence information


Nucleotide sequence

ATGGCTTTAACCAACCCACGGAACAGCTCATCAGTTATCATGTTCATCTTCTTGGGATTC
TCAGACCACCCAGAACTCCGAACCTTCCTCTTTCTGACTTTCCTGGGCATCTATCTCGTG
ACCTTGACCTGGAACCTGGCCCTCATCTTTCTGATCAGAGGTGACATCCGTTTACACACA
CCCATGTACTTCTTCCTCAGCAACTTATCCTTCGTTGACATTTGCTACTCATCCTCTGTA
GCTCCCAAGATGCTCTTTGATTTCTTTCGAGAGCAGAAGACTATCTCATTCCTGGGATGT
GCTGCCCAGTTCTTTTTCTTTGTTGGTTTGGGCCTAACTGAGTGTTTCCTGCTAACAGCA
ATGGCATATGATAGATATGCAGCCATCTCGAACCCCCTGCTTTATATGACCATCATGCAC
CAGGGTCTCTGCATGCGTATGGTGGCTGGGGCATATCTTGGTGGCTTCCTGAGTTCTTTT
ATTCAGGCCAGTTCCATATTTCAACTCTGCTTTTGTGGGCCAAATGTCATCAACCACTTC
TTCTGCGACCTCCCACCAATCCTGGCACTTTCTTGCTCTAACACATTCTTCAGCCAAGTG
GTCAATTTCCTTGTAGTGATCACAGTAGGAGGGACATCATTTCTCATCCTCCTGGTCTCC
TACAGTTACATAGTGTCTGCTGTCTTGAAGATCCACTCTGTGAAAGGCCGATGGAAAGCC
TTCAACACATGTGCCTCACACCTCATGGCAGTGACCATGCTGTTTGGGACAGCACTTTTC
ATGTACCTGCGGCCCAGCTCCAGCTACTCATTTAGCAGAGACAAGGTAGTGTCTGTCTTC
TATTCGCTGGTGATCCCTATGCTGAACCCTCTCATTTACAGTTTGAGGAACAAAGAGATC
AAAGATGCCCTGTGGAAAATGATAGAGAAAAGGAAAGTGTTTACTAACTTG


Conceptual translation

MALTNPRNSSSVIMFIFLGFSDHPELRTFLFLTFLGIYLVTLTWNLALIFLIRGDIRLHT
PMYFFLSNLSFVDICYSSSVAPKMLFDFFREQKTISFLGCAAQFFFFVGLGLTECFLLTA
MAYDRYAAISNPLLYMTIMHQGLCMRMVAGAYLGGFLSSFIQASSIFQLCFCGPNVINHF
FCDLPPILALSCSNTFFSQVVNFLVVITVGGTSFLILLVSYSYIVSAVLKIHSVKGRWKA
FNTCASHLMAVTMLFGTALFMYLRPSSSYSFSRDKVVSVFYSLVIPMLNPLIYSLRNKEI
KDALWKMIEKRKVFTNL