Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5a21 Olfactory Receptor

Gene Symbol Or5a21
Organism Mouse
Family 5
Subfamily a
Pseudo No
Location chr19:12,332,900-12,333,900 (-)
Aliases Olfr1438

Sequence information


Nucleotide sequence

MAGGRNSTVVTRFILLGFSDQPQMKIFLFMLFLGIYILTLAWNLSLITLIRMDSHLHTPM
YFFLSNLSFLDICYSSSTAPKMLSDIVTDKNTISFLGCATQYFVFCGMGLTECLLLAAMA
YDRYTAVCNPLLYMALMSHTLCLKLVAGAYMGGFLSSLIATCSIYQHDFCGPNIINHFFC
DLPPVLALACSDIFTSQVVTFILGVIVGVMSVLVVLISYGYIIAAVLRINSAKGRTKAFS
TSASHLTAVTLFYGSGLFMYMRPNSSYSLGQDKVASVFYAVVVPMMNPIIYSLRNKDIKN
AVRKAVERDSMLSHGYSFF


Conceptual translation

MAGGRNSTVVTRFILLGFSDQPQMKIFLFMLFLGIYILTLAWNLSLITLIRMDSHLHTPM
YFFLSNLSFLDICYSSSTAPKMLSDIVTDKNTISFLGCATQYFVFCGMGLTECLLLAAMA
YDRYTAVCNPLLYMALMSHTLCLKLVAGAYMGGFLSSLIATCSIYQHDFCGPNIINHFFC
DLPPVLALACSDIFTSQVVTFILGVIVGVMSVLVVLISYGYIIAAVLRINSAKGRTKAFS
TSASHLTAVTLFYGSGLFMYMRPNSSYSLGQDKVASVFYAVVVPMMNPIIYSLRNKDIKN
AVRKAVERDSMLSHGYSFF